Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/CC2985(antitoxin)
Location 96210..96742 Replicon plasmid pWSM1274_3
Accession NZ_CP104141
Organism Rhizobium leguminosarum bv. viciae strain WSM1274

Toxin (Protein)


Gene name parE Uniprot ID -
Locus tag N2600_RS32235 Protein ID WP_017968612.1
Coordinates 96210..96503 (-) Length 98 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID -
Locus tag N2600_RS32240 Protein ID WP_260299791.1
Coordinates 96500..96742 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N2600_RS32220 (N2600_32220) 92326..93675 + 1350 WP_260112151.1 8-oxoguanine deaminase -
N2600_RS32225 (N2600_32225) 93685..94917 + 1233 WP_260112152.1 amidohydrolase family protein -
N2600_RS32230 (N2600_32230) 95368..95928 - 561 Protein_94 helix-turn-helix domain-containing protein -
N2600_RS32235 (N2600_32235) 96210..96503 - 294 WP_017968612.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
N2600_RS32240 (N2600_32240) 96500..96742 - 243 WP_260299791.1 type II toxin-antitoxin system ParD family antitoxin Antitoxin
N2600_RS32245 (N2600_32245) 96908..97810 - 903 WP_222293944.1 MBL fold metallo-hydrolase -
N2600_RS32250 (N2600_32250) 97915..98547 - 633 WP_260299792.1 DsbA family protein -
N2600_RS32255 (N2600_32255) 98662..99555 + 894 WP_260299793.1 LysR family transcriptional regulator -
N2600_RS32260 (N2600_32260) 99704..99970 + 267 WP_162117541.1 acylphosphatase -
N2600_RS32265 (N2600_32265) 100126..100776 + 651 WP_260299794.1 Rieske (2Fe-2S) protein -
N2600_RS32270 (N2600_32270) 100773..101618 + 846 WP_260299795.1 aromatic ring-hydroxylating dioxygenase subunit alpha -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..307811 307811
- flank IS/Tn - - 95197..95928 731


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-92)

Antitoxin

Antitoxin ParD

(11-63)


Sequences

Toxin        


Download         Length: 98 a.a.        Molecular weight: 11238.74 Da        Isoelectric Point: 5.1668

>T257333 WP_017968612.1 NZ_CP104141:c96503-96210 [Rhizobium leguminosarum bv. viciae]
MSFRLSAEAEEDIIAIAEQGVRLFGAGQAKRYHDELFALFDLIAANPRIARERDEIDPPVRIHPFKAHLIVYRIENDETI
FVIRIRHAHEDWATDSI

Download         Length: 294 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8843.96 Da        Isoelectric Point: 9.7765

>AT257333 WP_260299791.1 NZ_CP104141:c96742-96500 [Rhizobium leguminosarum bv. viciae]
MATMNVSLPGAMKDWVEAQARTGRYSNASDYVRDLIRRDQTRNDKIAAMQSFVEAGLQSGVGVRSKDELFAEAMARTSKS

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References