Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN(toxin)
Location 864187..864854 Replicon plasmid pWSM1274_1
Accession NZ_CP104139
Organism Rhizobium leguminosarum bv. viciae strain WSM1274

Toxin (Protein)


Gene name vapC Uniprot ID W0IUA5
Locus tag N2600_RS28310 Protein ID WP_025397970.1
Coordinates 864187..864630 (-) Length 148 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag N2600_RS28315 Protein ID WP_206120837.1
Coordinates 864627..864854 (-) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N2600_RS28285 (N2600_28285) 859518..859820 + 303 WP_260299020.1 antibiotic biosynthesis monooxygenase -
N2600_RS28290 (N2600_28290) 860011..860715 + 705 WP_026154458.1 carbonic anhydrase -
N2600_RS28295 (N2600_28295) 860720..862246 + 1527 WP_260299021.1 SulP family inorganic anion transporter -
N2600_RS28300 (N2600_28300) 862509..862753 + 245 Protein_813 DUF983 domain-containing protein -
N2600_RS28305 (N2600_28305) 862989..863948 - 960 WP_260299022.1 EamA family transporter -
N2600_RS28310 (N2600_28310) 864187..864630 - 444 WP_025397970.1 PIN domain-containing protein Toxin
N2600_RS28315 (N2600_28315) 864627..864854 - 228 WP_206120837.1 CopG family transcriptional regulator Antitoxin
N2600_RS28320 (N2600_28320) 865212..866183 + 972 WP_222350819.1 AraC family transcriptional regulator -
N2600_RS28325 (N2600_28325) 866279..866932 + 654 WP_260299023.1 nitroreductase family protein -
N2600_RS28330 (N2600_28330) 866965..867510 + 546 WP_128439468.1 carboxymuconolactone decarboxylase family protein -
N2600_RS28335 (N2600_28335) 867553..868260 + 708 WP_170283067.1 NAD(P)H-dependent oxidoreductase -
N2600_RS28340 (N2600_28340) 868335..868802 + 468 WP_260299466.1 DUF3788 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..1180112 1180112


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-131)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 148 a.a.        Molecular weight: 15581.80 Da        Isoelectric Point: 7.4219

>T257331 WP_025397970.1 NZ_CP104139:c864630-864187 [Rhizobium leguminosarum bv. viciae]
VTFLLDVNVLIALIDPGHVAHDDAHEWFAAIGQSAWASCPITENGVIRIVGNPKYPNSPGSPSLVMEIVRKLRSLPGHSF
WPDDVSLVGSGDIAPTKILTSGQVTDTYLLALAKARGGQLATFDRKLSAAAVTRGNSALHLITTSRS

Download         Length: 444 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8206.36 Da        Isoelectric Point: 7.0120

>AT257331 WP_206120837.1 NZ_CP104139:c864854-864627 [Rhizobium leguminosarum bv. viciae]
MRTTLAIDDDVLTAAKAMATQQHRSVGEVISELARRSLRRPPSSGERNGIPLLSTRPDTPPVTLEIVNAMRDEVP

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB W0IUA5

Antitoxin

Source ID Structure

References