Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 851638..852428 | Replicon | plasmid pWSM1274_1 |
| Accession | NZ_CP104139 | ||
| Organism | Rhizobium leguminosarum bv. viciae strain WSM1274 | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | - |
| Locus tag | N2600_RS28250 | Protein ID | WP_222351353.1 |
| Coordinates | 851931..852428 (+) | Length | 166 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | - |
| Locus tag | N2600_RS28245 | Protein ID | WP_222282267.1 |
| Coordinates | 851638..851934 (+) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N2600_RS28210 (N2600_28210) | 847371..847577 | + | 207 | Protein_795 | hypothetical protein | - |
| N2600_RS28215 (N2600_28215) | 847607..848371 | - | 765 | WP_260299015.1 | Crp/Fnr family transcriptional regulator | - |
| N2600_RS28220 (N2600_28220) | 848476..848711 | - | 236 | Protein_797 | hypothetical protein | - |
| N2600_RS28225 (N2600_28225) | 849307..849483 | + | 177 | Protein_798 | DUF1515 domain-containing protein | - |
| N2600_RS28230 (N2600_28230) | 849958..850446 | + | 489 | WP_170283121.1 | hypothetical protein | - |
| N2600_RS28235 (N2600_28235) | 850590..850784 | + | 195 | WP_260299495.1 | hypothetical protein | - |
| N2600_RS28240 (N2600_28240) | 850940..851310 | - | 371 | Protein_801 | transposase | - |
| N2600_RS28245 (N2600_28245) | 851638..851934 | + | 297 | WP_222282267.1 | DUF1778 domain-containing protein | Antitoxin |
| N2600_RS28250 (N2600_28250) | 851931..852428 | + | 498 | WP_222351353.1 | GNAT family N-acetyltransferase | Toxin |
| N2600_RS28255 (N2600_28255) | 852762..854930 | + | 2169 | WP_260299016.1 | EAL domain-containing protein | - |
| N2600_RS28260 (N2600_28260) | 855743..855970 | - | 228 | WP_260299017.1 | hypothetical protein | - |
| N2600_RS28265 (N2600_28265) | 856285..856502 | + | 218 | Protein_806 | helix-turn-helix domain-containing protein | - |
| N2600_RS28270 (N2600_28270) | 856872..857143 | - | 272 | Protein_807 | PAS domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..1180112 | 1180112 | |
| - | flank | IS/Tn | - | - | 851008..851310 | 302 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 166 a.a. Molecular weight: 17782.34 Da Isoelectric Point: 7.4217
>T257330 WP_222351353.1 NZ_CP104139:851931-852428 [Rhizobium leguminosarum bv. viciae]
VTLSVPAPLADHHELAEFHSGVPELDDWLRLRARANQASGASRTFVVCEASRVIAYYALASGAVRQSEAPGRFRRNMPDP
IPVAVLGRLAIDQTYQGRGFGRALVRDAGLRLINAAEILGIRGVLVHAISDDARAFYQAVGFLPSPSDPMMLLVGLHDLN
NALTS
VTLSVPAPLADHHELAEFHSGVPELDDWLRLRARANQASGASRTFVVCEASRVIAYYALASGAVRQSEAPGRFRRNMPDP
IPVAVLGRLAIDQTYQGRGFGRALVRDAGLRLINAAEILGIRGVLVHAISDDARAFYQAVGFLPSPSDPMMLLVGLHDLN
NALTS
Download Length: 498 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|