Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 840874..841544 | Replicon | plasmid pWSM1274_1 |
| Accession | NZ_CP104139 | ||
| Organism | Rhizobium leguminosarum bv. viciae strain WSM1274 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | N2600_RS28185 | Protein ID | WP_260299012.1 |
| Coordinates | 841125..841544 (+) | Length | 140 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | N2600_RS28180 | Protein ID | WP_170283097.1 |
| Coordinates | 840874..841128 (+) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N2600_RS28150 (N2600_28150) | 836141..836518 | - | 378 | Protein_783 | transposase | - |
| N2600_RS28155 (N2600_28155) | 836732..837610 | + | 879 | WP_260299008.1 | SDR family oxidoreductase | - |
| N2600_RS28160 (N2600_28160) | 837790..838248 | - | 459 | WP_260299009.1 | DUF305 domain-containing protein | - |
| N2600_RS28165 (N2600_28165) | 838538..838957 | - | 420 | WP_260299010.1 | GNAT family N-acetyltransferase | - |
| N2600_RS28170 (N2600_28170) | 839451..840374 | - | 924 | WP_260299011.1 | LuxR C-terminal-related transcriptional regulator | - |
| N2600_RS28175 (N2600_28175) | 840371..840598 | - | 228 | WP_206120837.1 | CopG family transcriptional regulator | - |
| N2600_RS28180 (N2600_28180) | 840874..841128 | + | 255 | WP_170283097.1 | plasmid stabilization protein | Antitoxin |
| N2600_RS28185 (N2600_28185) | 841125..841544 | + | 420 | WP_260299012.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| N2600_RS28190 (N2600_28190) | 841972..842100 | - | 129 | Protein_791 | IS256 family transposase | - |
| N2600_RS28195 (N2600_28195) | 842472..843620 | + | 1149 | WP_260299013.1 | hypothetical protein | - |
| N2600_RS28200 (N2600_28200) | 843921..845177 | - | 1257 | WP_170283095.1 | sodium:proton antiporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..1180112 | 1180112 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15097.35 Da Isoelectric Point: 5.1864
>T257329 WP_260299012.1 NZ_CP104139:841125-841544 [Rhizobium leguminosarum bv. viciae]
MILLDTNVISEPWKPVPDEAVIAWLDAQAIETLFLSAITIAELRSGIAAMPSGKRQTILRDRLEGEVLPHFSERILSFDL
AASQFYSELMARARVSGRAIGTADGYIAATAAANGLAIATRDTSPFEAARLKVINPWSR
MILLDTNVISEPWKPVPDEAVIAWLDAQAIETLFLSAITIAELRSGIAAMPSGKRQTILRDRLEGEVLPHFSERILSFDL
AASQFYSELMARARVSGRAIGTADGYIAATAAANGLAIATRDTSPFEAARLKVINPWSR
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|