Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-RelB |
| Location | 719618..720216 | Replicon | plasmid pWSM1274_1 |
| Accession | NZ_CP104139 | ||
| Organism | Rhizobium leguminosarum bv. viciae strain WSM1274 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | N2600_RS27525 | Protein ID | WP_130728017.1 |
| Coordinates | 719923..720216 (+) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A7Y2RA27 |
| Locus tag | N2600_RS27520 | Protein ID | WP_018068225.1 |
| Coordinates | 719618..719926 (+) | Length | 103 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N2600_RS27500 (N2600_27500) | 716421..716579 | + | 159 | WP_003549679.1 | cbb3-type cytochrome oxidase assembly protein CcoS | - |
| N2600_RS27505 (N2600_27505) | 716614..717285 | + | 672 | WP_011654245.1 | Crp/Fnr family transcriptional regulator | - |
| N2600_RS27510 (N2600_27510) | 717644..718357 | - | 714 | WP_003549684.1 | GntR family transcriptional regulator | - |
| N2600_RS27515 (N2600_27515) | 718975..719343 | - | 369 | Protein_656 | transposase | - |
| N2600_RS27520 (N2600_27520) | 719618..719926 | + | 309 | WP_018068225.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| N2600_RS27525 (N2600_27525) | 719923..720216 | + | 294 | WP_130728017.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N2600_RS27530 (N2600_27530) | 720545..721861 | - | 1317 | WP_260299460.1 | aspartate--tRNA(Asn) ligase | - |
| N2600_RS27535 (N2600_27535) | 722293..722916 | + | 624 | WP_260298954.1 | recombinase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..1180112 | 1180112 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 10692.31 Da Isoelectric Point: 8.5412
>T257328 WP_130728017.1 NZ_CP104139:719923-720216 [Rhizobium leguminosarum bv. viciae]
VKLTWSAFALSDRDAIFTYIEAENPSAAILVDERIVAAVRRLVDFPASGRVGRIAGTRELVINGTPYVAAYAITETAVRI
LRILHGAQEWPDTLPKR
VKLTWSAFALSDRDAIFTYIEAENPSAAILVDERIVAAVRRLVDFPASGRVGRIAGTRELVINGTPYVAAYAITETAVRI
LRILHGAQEWPDTLPKR
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|