Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-StbC
Location 51268..51944 Replicon plasmid pWSM1274_1
Accession NZ_CP104139
Organism Rhizobium leguminosarum bv. viciae strain WSM1274

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag N2600_RS24495 Protein ID WP_260299145.1
Coordinates 51519..51944 (+) Length 142 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A7Y2R170
Locus tag N2600_RS24490 Protein ID WP_017967320.1
Coordinates 51268..51522 (+) Length 85 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N2600_RS24460 (N2600_24460) 46722..47367 + 646 Protein_45 TetR/AcrR family transcriptional regulator -
N2600_RS24465 (N2600_24465) 47404..47601 + 198 Protein_46 DUF1217 domain-containing protein -
N2600_RS24470 (N2600_24470) 48048..48887 + 840 WP_017967324.1 transporter substrate-binding domain-containing protein -
N2600_RS24475 (N2600_24475) 49004..49666 + 663 WP_017967323.1 amino acid ABC transporter permease -
N2600_RS24480 (N2600_24480) 49672..50331 + 660 WP_017967322.1 amino acid ABC transporter permease -
N2600_RS24485 (N2600_24485) 50343..51113 + 771 WP_017967321.1 amino acid ABC transporter ATP-binding protein -
N2600_RS24490 (N2600_24490) 51268..51522 + 255 WP_017967320.1 plasmid stabilization protein Antitoxin
N2600_RS24495 (N2600_24495) 51519..51944 + 426 WP_260299145.1 type II toxin-antitoxin system VapC family toxin Toxin
N2600_RS24500 (N2600_24500) 52138..52890 + 753 WP_170259716.1 GntR family transcriptional regulator -
N2600_RS24505 (N2600_24505) 52884..53669 + 786 WP_170259717.1 transporter substrate-binding domain-containing protein -
N2600_RS24510 (N2600_24510) 53751..54422 + 672 WP_260299146.1 amino acid ABC transporter permease -
N2600_RS24515 (N2600_24515) 54419..55078 + 660 WP_260299147.1 amino acid ABC transporter permease -
N2600_RS24520 (N2600_24520) 55056..55781 + 726 WP_130746160.1 amino acid ABC transporter ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..1180112 1180112


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(2-123)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 142 a.a.        Molecular weight: 14978.15 Da        Isoelectric Point: 4.5882

>T257325 WP_260299145.1 NZ_CP104139:51519-51944 [Rhizobium leguminosarum bv. viciae]
MIILDTNVVSEAMKPAPDETVKSWLDEQAAETLFLSSVTIAELMFGIGALPAGKRKERLSDALDGLMELFERRILAFDIT
AARRYADLAVKARAAGRGFPTPDGYIAAIAASKGFAVATRDTSAFDAAGVEVINPWAASTA

Download         Length: 426 bp

Antitoxin


Download         Length: 85 a.a.        Molecular weight: 9260.57 Da        Isoelectric Point: 9.0495

>AT257325 WP_017967320.1 NZ_CP104139:51268-51522 [Rhizobium leguminosarum bv. viciae]
MPAVTIRNLSEATHRALKVRAAHHGRSAEAEMREILEAAVRPETRLHLGSALAERSRRLGLTNEDLAVLDQARDALPAKP
LSFE

Download         Length: 255 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A7Y2R170

References