Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 51268..51944 | Replicon | plasmid pWSM1274_1 |
| Accession | NZ_CP104139 | ||
| Organism | Rhizobium leguminosarum bv. viciae strain WSM1274 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | N2600_RS24495 | Protein ID | WP_260299145.1 |
| Coordinates | 51519..51944 (+) | Length | 142 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A7Y2R170 |
| Locus tag | N2600_RS24490 | Protein ID | WP_017967320.1 |
| Coordinates | 51268..51522 (+) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N2600_RS24460 (N2600_24460) | 46722..47367 | + | 646 | Protein_45 | TetR/AcrR family transcriptional regulator | - |
| N2600_RS24465 (N2600_24465) | 47404..47601 | + | 198 | Protein_46 | DUF1217 domain-containing protein | - |
| N2600_RS24470 (N2600_24470) | 48048..48887 | + | 840 | WP_017967324.1 | transporter substrate-binding domain-containing protein | - |
| N2600_RS24475 (N2600_24475) | 49004..49666 | + | 663 | WP_017967323.1 | amino acid ABC transporter permease | - |
| N2600_RS24480 (N2600_24480) | 49672..50331 | + | 660 | WP_017967322.1 | amino acid ABC transporter permease | - |
| N2600_RS24485 (N2600_24485) | 50343..51113 | + | 771 | WP_017967321.1 | amino acid ABC transporter ATP-binding protein | - |
| N2600_RS24490 (N2600_24490) | 51268..51522 | + | 255 | WP_017967320.1 | plasmid stabilization protein | Antitoxin |
| N2600_RS24495 (N2600_24495) | 51519..51944 | + | 426 | WP_260299145.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| N2600_RS24500 (N2600_24500) | 52138..52890 | + | 753 | WP_170259716.1 | GntR family transcriptional regulator | - |
| N2600_RS24505 (N2600_24505) | 52884..53669 | + | 786 | WP_170259717.1 | transporter substrate-binding domain-containing protein | - |
| N2600_RS24510 (N2600_24510) | 53751..54422 | + | 672 | WP_260299146.1 | amino acid ABC transporter permease | - |
| N2600_RS24515 (N2600_24515) | 54419..55078 | + | 660 | WP_260299147.1 | amino acid ABC transporter permease | - |
| N2600_RS24520 (N2600_24520) | 55056..55781 | + | 726 | WP_130746160.1 | amino acid ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..1180112 | 1180112 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 14978.15 Da Isoelectric Point: 4.5882
>T257325 WP_260299145.1 NZ_CP104139:51519-51944 [Rhizobium leguminosarum bv. viciae]
MIILDTNVVSEAMKPAPDETVKSWLDEQAAETLFLSSVTIAELMFGIGALPAGKRKERLSDALDGLMELFERRILAFDIT
AARRYADLAVKARAAGRGFPTPDGYIAAIAASKGFAVATRDTSAFDAAGVEVINPWAASTA
MIILDTNVVSEAMKPAPDETVKSWLDEQAAETLFLSSVTIAELMFGIGALPAGKRKERLSDALDGLMELFERRILAFDIT
AARRYADLAVKARAAGRGFPTPDGYIAAIAASKGFAVATRDTSAFDAAGVEVINPWAASTA
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|