Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 744158..744738 | Replicon | plasmid pC101c |
Accession | NZ_CP104137 | ||
Organism | Sinorhizobium sp. C101 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | N0R80_RS31125 | Protein ID | WP_275598578.1 |
Coordinates | 744158..744541 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | N0R80_RS31130 | Protein ID | WP_275598577.1 |
Coordinates | 744538..744738 (-) | Length | 67 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0R80_RS31095 (N0R80_31100) | 739699..740112 | + | 414 | WP_275598582.1 | hypothetical protein | - |
N0R80_RS31100 (N0R80_31105) | 740482..741156 | + | 675 | WP_275600301.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
N0R80_RS31105 (N0R80_31110) | 741889..742509 | + | 621 | WP_275598581.1 | hypothetical protein | - |
N0R80_RS31110 (N0R80_31115) | 742661..742915 | + | 255 | WP_275598580.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
N0R80_RS31115 (N0R80_31120) | 742912..743334 | + | 423 | WP_275598579.1 | type II toxin-antitoxin system VapC family toxin | - |
N0R80_RS31120 (N0R80_31125) | 743676..744065 | + | 390 | WP_102761961.1 | ester cyclase | - |
N0R80_RS31125 (N0R80_31130) | 744158..744541 | - | 384 | WP_275598578.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N0R80_RS31130 (N0R80_31135) | 744538..744738 | - | 201 | WP_275598577.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
N0R80_RS31135 (N0R80_31150) | 745118..746404 | + | 1287 | WP_275598576.1 | calcium-binding protein | - |
N0R80_RS31140 (N0R80_31155) | 746341..747066 | + | 726 | WP_275598575.1 | calcium-binding protein | - |
N0R80_RS31145 (N0R80_31160) | 747432..748133 | + | 702 | WP_275598574.1 | class I SAM-dependent methyltransferase | - |
N0R80_RS31150 (N0R80_31165) | 748105..748902 | - | 798 | WP_275598573.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..772646 | 772646 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14269.53 Da Isoelectric Point: 7.5964
>T257324 WP_275598578.1 NZ_CP104137:c744541-744158 [Sinorhizobium sp. C101]
VILADTSIWIDHFRHTDAELRRIVEDDRLLCHPAVIGELALGSLRERSSVIAFLMAQREALVATHHEVMMMVDRHAIFSM
GIGYTDAHLLASVLLDKRVALWTRDKRLRAAAEKAGASLHTPAHTRN
VILADTSIWIDHFRHTDAELRRIVEDDRLLCHPAVIGELALGSLRERSSVIAFLMAQREALVATHHEVMMMVDRHAIFSM
GIGYTDAHLLASVLLDKRVALWTRDKRLRAAAEKAGASLHTPAHTRN
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|