Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 744158..744738 Replicon plasmid pC101c
Accession NZ_CP104137
Organism Sinorhizobium sp. C101

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag N0R80_RS31125 Protein ID WP_275598578.1
Coordinates 744158..744541 (-) Length 128 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag N0R80_RS31130 Protein ID WP_275598577.1
Coordinates 744538..744738 (-) Length 67 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N0R80_RS31095 (N0R80_31100) 739699..740112 + 414 WP_275598582.1 hypothetical protein -
N0R80_RS31100 (N0R80_31105) 740482..741156 + 675 WP_275600301.1 MarR family winged helix-turn-helix transcriptional regulator -
N0R80_RS31105 (N0R80_31110) 741889..742509 + 621 WP_275598581.1 hypothetical protein -
N0R80_RS31110 (N0R80_31115) 742661..742915 + 255 WP_275598580.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
N0R80_RS31115 (N0R80_31120) 742912..743334 + 423 WP_275598579.1 type II toxin-antitoxin system VapC family toxin -
N0R80_RS31120 (N0R80_31125) 743676..744065 + 390 WP_102761961.1 ester cyclase -
N0R80_RS31125 (N0R80_31130) 744158..744541 - 384 WP_275598578.1 type II toxin-antitoxin system VapC family toxin Toxin
N0R80_RS31130 (N0R80_31135) 744538..744738 - 201 WP_275598577.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
N0R80_RS31135 (N0R80_31150) 745118..746404 + 1287 WP_275598576.1 calcium-binding protein -
N0R80_RS31140 (N0R80_31155) 746341..747066 + 726 WP_275598575.1 calcium-binding protein -
N0R80_RS31145 (N0R80_31160) 747432..748133 + 702 WP_275598574.1 class I SAM-dependent methyltransferase -
N0R80_RS31150 (N0R80_31165) 748105..748902 - 798 WP_275598573.1 ABC transporter ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..772646 772646


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(2-113)

Antitoxin

Bacterial antitoxin of type II TA system, VapB

(1-42)


Sequences

Toxin        


Download         Length: 128 a.a.        Molecular weight: 14269.53 Da        Isoelectric Point: 7.5964

>T257324 WP_275598578.1 NZ_CP104137:c744541-744158 [Sinorhizobium sp. C101]
VILADTSIWIDHFRHTDAELRRIVEDDRLLCHPAVIGELALGSLRERSSVIAFLMAQREALVATHHEVMMMVDRHAIFSM
GIGYTDAHLLASVLLDKRVALWTRDKRLRAAAEKAGASLHTPAHTRN

Download         Length: 384 bp

Antitoxin


Download         Length: 67 a.a.        Molecular weight: 7011.11 Da        Isoelectric Point: 10.7473

>AT257324 WP_275598577.1 NZ_CP104137:c744738-744538 [Sinorhizobium sp. C101]
MRSTINLDDALMETAKSLTGTKETAALVRQALETLVRVESGKRLIALGGTMPDAEAAPRRRSAAAK

Download         Length: 201 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References