Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 616252..616922 | Replicon | plasmid pC101c |
Accession | NZ_CP104137 | ||
Organism | Sinorhizobium sp. C101 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | N0R80_RS30520 | Protein ID | WP_275598668.1 |
Coordinates | 616252..616671 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | N0R80_RS30525 | Protein ID | WP_275598667.1 |
Coordinates | 616668..616922 (-) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0R80_RS30500 (N0R80_30505) | 611358..612274 | - | 917 | Protein_604 | DnaJ C-terminal domain-containing protein | - |
N0R80_RS30505 (N0R80_30510) | 612357..612719 | - | 363 | WP_275598670.1 | response regulator | - |
N0R80_RS30510 (N0R80_30515) | 612746..615280 | - | 2535 | WP_275598689.1 | PAS domain S-box protein | - |
N0R80_RS30515 (N0R80_30520) | 615676..616083 | + | 408 | WP_275598669.1 | GFA family protein | - |
N0R80_RS30520 (N0R80_30525) | 616252..616671 | - | 420 | WP_275598668.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N0R80_RS30525 (N0R80_30530) | 616668..616922 | - | 255 | WP_275598667.1 | plasmid stabilization protein | Antitoxin |
N0R80_RS30530 (N0R80_30535) | 617111..618073 | - | 963 | WP_275598666.1 | ATP-binding cassette domain-containing protein | - |
N0R80_RS30535 (N0R80_30540) | 618070..618982 | - | 913 | Protein_611 | ABC transporter ATP-binding protein | - |
N0R80_RS30540 (N0R80_30545) | 618979..619800 | - | 822 | WP_275598664.1 | ABC transporter permease | - |
N0R80_RS30545 (N0R80_30550) | 619806..620741 | - | 936 | WP_275598663.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..772646 | 772646 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 14859.15 Da Isoelectric Point: 5.7116
>T257323 WP_275598668.1 NZ_CP104137:c616671-616252 [Sinorhizobium sp. C101]
MIVLDTNVVSEVMKPAADPAVRSWLNEQVAETLYLASVTLAELLFGIGALPDGRRKKALAEMFDGVLELFGDRVLPFDIG
AARYYAGLAVTARAAGKGFPTPDGYIAAIAASRGFLVATRDISPFEAAGLTVVNPWHHR
MIVLDTNVVSEVMKPAADPAVRSWLNEQVAETLYLASVTLAELLFGIGALPDGRRKKALAEMFDGVLELFGDRVLPFDIG
AARYYAGLAVTARAAGKGFPTPDGYIAAIAASRGFLVATRDISPFEAAGLTVVNPWHHR
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|