Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE-RelB
Location 40940..41538 Replicon plasmid pC101c
Accession NZ_CP104137
Organism Sinorhizobium sp. C101

Toxin (Protein)


Gene name relE Uniprot ID Q930F0
Locus tag N0R80_RS27680 Protein ID WP_010967243.1
Coordinates 41245..41538 (+) Length 98 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag N0R80_RS27675 Protein ID WP_275598527.1
Coordinates 40940..41248 (+) Length 103 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N0R80_RS27640 (N0R80_27640) 36003..36452 + 450 WP_275598531.1 hypothetical protein -
N0R80_RS27645 (N0R80_27645) 36449..36850 + 402 WP_275598530.1 periplasmic heavy metal sensor -
N0R80_RS27650 (N0R80_27650) 37063..37956 + 894 WP_275598529.1 AraC family transcriptional regulator -
N0R80_RS27655 (N0R80_27655) 38033..38260 + 228 WP_003525968.1 hypothetical protein -
N0R80_RS27660 (N0R80_27660) 38445..38978 - 534 Protein_37 short-chain dehydrogenase -
N0R80_RS27665 (N0R80_27665) 39177..39293 + 117 Protein_38 cation transporter -
N0R80_RS27670 (N0R80_27670) 40306..40734 + 429 WP_275598528.1 GNAT family N-acetyltransferase -
N0R80_RS27675 (N0R80_27675) 40940..41248 + 309 WP_275598527.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
N0R80_RS27680 (N0R80_27680) 41245..41538 + 294 WP_010967243.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
N0R80_RS27685 (N0R80_27685) 41799..42999 - 1201 Protein_42 NAD-dependent formate dehydrogenase -
N0R80_RS27690 (N0R80_27690) 43190..43491 + 302 Protein_43 plasmid partitioning protein RepB C-terminal domain-containing protein -
N0R80_RS27695 (N0R80_27695) 43659..44789 + 1131 WP_275598525.1 IS1595 family transposase -
N0R80_RS27700 (N0R80_27700) 44997..45389 + 393 WP_275598524.1 response regulator -
N0R80_RS27705 (N0R80_27705) 45647..45742 - 96 Protein_46 cold-shock protein -
N0R80_RS27710 (N0R80_27710) 45791..46033 - 243 WP_275598523.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..772646 772646
- flank IS/Tn - - 43659..44789 1130


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-90)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-60)


Sequences

Toxin        


Download         Length: 98 a.a.        Molecular weight: 11278.93 Da        Isoelectric Point: 6.4734

>T257322 WP_010967243.1 NZ_CP104137:41245-41538 [Sinorhizobium sp. C101]
MRLVWARYALDDRDTIFSYIERENPRAAVHVDEEIVSAVRRLLDFPESGRPGRIAGTRELVIPRTPYIAAYMVMEDRIRI
LRVLHGAQKWPSELDDG

Download         Length: 294 bp

Antitoxin


Download         Length: 103 a.a.        Molecular weight: 11224.61 Da        Isoelectric Point: 5.6604

>AT257322 WP_275598527.1 NZ_CP104137:40940-41248 [Sinorhizobium sp. C101]
MASNALVQTRIDAEIKERATAVLENMGLTVSDAVRILLTRTANEGALPLELFSHSEAHDAWFRAKVLRALEDTRPDVDDA
DADAHFRERRAAALRKAAAGDR

Download         Length: 309 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q930F0

Antitoxin

Source ID Structure

References