Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-RelB |
| Location | 40940..41538 | Replicon | plasmid pC101c |
| Accession | NZ_CP104137 | ||
| Organism | Sinorhizobium sp. C101 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | Q930F0 |
| Locus tag | N0R80_RS27680 | Protein ID | WP_010967243.1 |
| Coordinates | 41245..41538 (+) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | N0R80_RS27675 | Protein ID | WP_275598527.1 |
| Coordinates | 40940..41248 (+) | Length | 103 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N0R80_RS27640 (N0R80_27640) | 36003..36452 | + | 450 | WP_275598531.1 | hypothetical protein | - |
| N0R80_RS27645 (N0R80_27645) | 36449..36850 | + | 402 | WP_275598530.1 | periplasmic heavy metal sensor | - |
| N0R80_RS27650 (N0R80_27650) | 37063..37956 | + | 894 | WP_275598529.1 | AraC family transcriptional regulator | - |
| N0R80_RS27655 (N0R80_27655) | 38033..38260 | + | 228 | WP_003525968.1 | hypothetical protein | - |
| N0R80_RS27660 (N0R80_27660) | 38445..38978 | - | 534 | Protein_37 | short-chain dehydrogenase | - |
| N0R80_RS27665 (N0R80_27665) | 39177..39293 | + | 117 | Protein_38 | cation transporter | - |
| N0R80_RS27670 (N0R80_27670) | 40306..40734 | + | 429 | WP_275598528.1 | GNAT family N-acetyltransferase | - |
| N0R80_RS27675 (N0R80_27675) | 40940..41248 | + | 309 | WP_275598527.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| N0R80_RS27680 (N0R80_27680) | 41245..41538 | + | 294 | WP_010967243.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | Toxin |
| N0R80_RS27685 (N0R80_27685) | 41799..42999 | - | 1201 | Protein_42 | NAD-dependent formate dehydrogenase | - |
| N0R80_RS27690 (N0R80_27690) | 43190..43491 | + | 302 | Protein_43 | plasmid partitioning protein RepB C-terminal domain-containing protein | - |
| N0R80_RS27695 (N0R80_27695) | 43659..44789 | + | 1131 | WP_275598525.1 | IS1595 family transposase | - |
| N0R80_RS27700 (N0R80_27700) | 44997..45389 | + | 393 | WP_275598524.1 | response regulator | - |
| N0R80_RS27705 (N0R80_27705) | 45647..45742 | - | 96 | Protein_46 | cold-shock protein | - |
| N0R80_RS27710 (N0R80_27710) | 45791..46033 | - | 243 | WP_275598523.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..772646 | 772646 | |
| - | flank | IS/Tn | - | - | 43659..44789 | 1130 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11278.93 Da Isoelectric Point: 6.4734
>T257322 WP_010967243.1 NZ_CP104137:41245-41538 [Sinorhizobium sp. C101]
MRLVWARYALDDRDTIFSYIERENPRAAVHVDEEIVSAVRRLLDFPESGRPGRIAGTRELVIPRTPYIAAYMVMEDRIRI
LRVLHGAQKWPSELDDG
MRLVWARYALDDRDTIFSYIERENPRAAVHVDEEIVSAVRRLLDFPESGRPGRIAGTRELVIPRTPYIAAYMVMEDRIRI
LRVLHGAQKWPSELDDG
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|