Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /RES-Xre |
Location | 713667..714599 | Replicon | plasmid pC101b |
Accession | NZ_CP104136 | ||
Organism | Sinorhizobium sp. C101 |
Toxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | N0R80_RS22850 | Protein ID | WP_275598965.1 |
Coordinates | 713667..714221 (-) | Length | 185 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | A0A2N8JW20 |
Locus tag | N0R80_RS22855 | Protein ID | WP_018097157.1 |
Coordinates | 714228..714599 (-) | Length | 124 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0R80_RS22835 (N0R80_22835) | 709128..710231 | + | 1104 | WP_275598968.1 | sulfate/molybdate ABC transporter ATP-binding protein | - |
N0R80_RS22840 (N0R80_22840) | 710343..711707 | + | 1365 | WP_275598967.1 | FAD-binding oxidoreductase | - |
N0R80_RS22845 (N0R80_22845) | 712017..712958 | - | 942 | WP_275600181.1 | IS110 family transposase | - |
N0R80_RS22850 (N0R80_22850) | 713667..714221 | - | 555 | WP_275598965.1 | RES family NAD+ phosphorylase | Toxin |
N0R80_RS22855 (N0R80_22855) | 714228..714599 | - | 372 | WP_018097157.1 | DUF2384 domain-containing protein | Antitoxin |
N0R80_RS22860 (N0R80_22860) | 714676..715461 | - | 786 | WP_275598964.1 | crotonase/enoyl-CoA hydratase family protein | - |
N0R80_RS22865 (N0R80_22865) | 715458..716327 | - | 870 | WP_275600182.1 | hydroxymethylglutaryl-CoA lyase | - |
N0R80_RS22870 (N0R80_22870) | 716324..718311 | - | 1988 | Protein_659 | acetyl/propionyl/methylcrotonyl-CoA carboxylase subunit alpha | - |
N0R80_RS22875 (N0R80_22875) | 718329..718712 | - | 384 | WP_100670781.1 | RidA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | htpB | 1..1695765 | 1695765 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 185 a.a. Molecular weight: 20341.28 Da Isoelectric Point: 6.7527
>T257321 WP_275598965.1 NZ_CP104136:c714221-713667 [Sinorhizobium sp. C101]
MRKHSPLVSRPDPEPTASVEPITLWRAFVPRWAHMPLSGAGAARFGGRWNPIGVPAIYGARELSTAWAEYNQGFVQHPAL
IVQLELLGARLADLTDVSLLVELGVDEAIHRCEWRDALDKGAVPETHRLQSELLARDFHGVIYPSFMSPGGTCVALWRWN
GPQEPRLGVIDPDGRLPKSPASWV
MRKHSPLVSRPDPEPTASVEPITLWRAFVPRWAHMPLSGAGAARFGGRWNPIGVPAIYGARELSTAWAEYNQGFVQHPAL
IVQLELLGARLADLTDVSLLVELGVDEAIHRCEWRDALDKGAVPETHRLQSELLARDFHGVIYPSFMSPGGTCVALWRWN
GPQEPRLGVIDPDGRLPKSPASWV
Download Length: 555 bp
Antitoxin
Download Length: 124 a.a. Molecular weight: 13109.26 Da Isoelectric Point: 9.9996
>AT257321 WP_018097157.1 NZ_CP104136:c714599-714228 [Sinorhizobium sp. C101]
MIALDFQIPAARFGDDHSPFLSARLVADRLGVTLAELAKLIGVARNTLTAKSGARKVDSALSKVVRILAMASEMAGDEAR
AVIWFKHQPIPGWAGKTAFDLVGEGKADKVLAYLESVRAGVYA
MIALDFQIPAARFGDDHSPFLSARLVADRLGVTLAELAKLIGVARNTLTAKSGARKVDSALSKVVRILAMASEMAGDEAR
AVIWFKHQPIPGWAGKTAFDLVGEGKADKVLAYLESVRAGVYA
Download Length: 372 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|