Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 563078..563885 | Replicon | plasmid pC101b |
Accession | NZ_CP104136 | ||
Organism | Sinorhizobium sp. C101 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | - |
Locus tag | N0R80_RS22195 | Protein ID | WP_100670374.1 |
Coordinates | 563361..563885 (+) | Length | 175 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | A0A2N8JWE8 |
Locus tag | N0R80_RS22190 | Protein ID | WP_018097027.1 |
Coordinates | 563078..563368 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0R80_RS22165 (N0R80_22165) | 558078..559028 | - | 951 | WP_275599053.1 | succinoglycan biosynthesis protein ExoV | - |
N0R80_RS22170 (N0R80_22170) | 559143..560100 | - | 958 | Protein_519 | succinoglycan biosynthesis glycosyltransferase ExoW | - |
N0R80_RS22175 (N0R80_22175) | 560224..561708 | + | 1485 | WP_275599052.1 | succinoglycan biosynthesis transport protein ExoT | - |
N0R80_RS22180 (N0R80_22180) | 562084..562658 | + | 575 | Protein_521 | thermonuclease family protein | - |
N0R80_RS22185 (N0R80_22185) | 562678..562935 | + | 258 | WP_018097026.1 | hypothetical protein | - |
N0R80_RS22190 (N0R80_22190) | 563078..563368 | + | 291 | WP_018097027.1 | DUF1778 domain-containing protein | Antitoxin |
N0R80_RS22195 (N0R80_22195) | 563361..563885 | + | 525 | WP_100670374.1 | GNAT family N-acetyltransferase | Toxin |
N0R80_RS22200 (N0R80_22200) | 564417..564800 | - | 384 | WP_102762399.1 | VOC family protein | - |
N0R80_RS22205 (N0R80_22205) | 564948..565448 | - | 501 | WP_275599050.1 | GNAT family N-acetyltransferase | - |
N0R80_RS22210 (N0R80_22210) | 565451..566581 | - | 1131 | WP_275599049.1 | sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC | - |
N0R80_RS22215 (N0R80_22215) | 566670..567899 | - | 1230 | WP_275599048.1 | extracellular solute-binding protein | - |
N0R80_RS22220 (N0R80_22220) | 567928..568785 | - | 858 | WP_100670384.1 | carbohydrate ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | htpB | 1..1695765 | 1695765 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 175 a.a. Molecular weight: 18532.30 Da Isoelectric Point: 7.3207
>T257320 WP_100670374.1 NZ_CP104136:563361-563885 [Sinorhizobium sp. C101]
VLDWREEPIGRHHDRKAFDCGTPELNEYLRRHARQNHEGGGSKTFVAVAPTAPETILGYYSISPASIAFAKVPAPLTKGL
GRYEVAVYRLARLAVALPLQGRGLGGDLLLAAGARALAVAAQVGGVALAIDAKDEKAACWYERFGAMPLLDSSPLSLILP
FKTIIDALDAAQGE
VLDWREEPIGRHHDRKAFDCGTPELNEYLRRHARQNHEGGGSKTFVAVAPTAPETILGYYSISPASIAFAKVPAPLTKGL
GRYEVAVYRLARLAVALPLQGRGLGGDLLLAAGARALAVAAQVGGVALAIDAKDEKAACWYERFGAMPLLDSSPLSLILP
FKTIIDALDAAQGE
Download Length: 525 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|