Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 464820..465490 | Replicon | plasmid pC101b |
| Accession | NZ_CP104136 | ||
| Organism | Sinorhizobium sp. C101 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | N0R80_RS21730 | Protein ID | WP_275599104.1 |
| Coordinates | 465044..465490 (+) | Length | 149 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | N0R80_RS21725 | Protein ID | WP_080636789.1 |
| Coordinates | 464820..465047 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N0R80_RS21710 (N0R80_21710) | 460046..461261 | + | 1216 | Protein_427 | YeeE/YedE family protein | - |
| N0R80_RS21715 (N0R80_21715) | 461643..462317 | + | 675 | WP_275600165.1 | hypothetical protein | - |
| N0R80_RS21720 (N0R80_21720) | 462788..464215 | + | 1428 | WP_275596165.1 | ISNCY family transposase | - |
| N0R80_RS21725 (N0R80_21725) | 464820..465047 | + | 228 | WP_080636789.1 | CopG family transcriptional regulator | Antitoxin |
| N0R80_RS21730 (N0R80_21730) | 465044..465490 | + | 447 | WP_275599104.1 | PIN domain-containing protein | Toxin |
| N0R80_RS21735 (N0R80_21735) | 465487..466392 | - | 906 | WP_275599103.1 | LysR family transcriptional regulator | - |
| N0R80_RS21740 (N0R80_21740) | 466487..466813 | + | 327 | WP_102763395.1 | nuclear transport factor 2 family protein | - |
| N0R80_RS21745 (N0R80_21745) | 466810..467599 | + | 790 | Protein_434 | SDR family oxidoreductase | - |
| N0R80_RS21750 (N0R80_21750) | 467804..469584 | + | 1781 | Protein_435 | monovalent cation:proton antiporter-2 (CPA2) family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | htpB | 1..1695765 | 1695765 | |
| - | flank | IS/Tn | - | - | 462788..464215 | 1427 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 149 a.a. Molecular weight: 15668.94 Da Isoelectric Point: 7.4219
>T257319 WP_275599104.1 NZ_CP104136:465044-465490 [Sinorhizobium sp. C101]
VTFLLDVNVLIALIDPGHVAHDDAHEWFAATGQTAWATCPITENGVIRIVGNPKYPNSPGSPSLVMEIVGKMRSLPGHSF
WPDDVSLVGSGDIAPTKILTSGQVTDTYLLALAKARGGQLATFDRKLSAAAVTRGNSALHLITATRVR
VTFLLDVNVLIALIDPGHVAHDDAHEWFAATGQTAWATCPITENGVIRIVGNPKYPNSPGSPSLVMEIVGKMRSLPGHSF
WPDDVSLVGSGDIAPTKILTSGQVTDTYLLALAKARGGQLATFDRKLSAAAVTRGNSALHLITATRVR
Download Length: 447 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|