Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-Phd |
Location | 138999..139660 | Replicon | plasmid pC101b |
Accession | NZ_CP104136 | ||
Organism | Sinorhizobium sp. C101 |
Toxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | N0R80_RS20295 | Protein ID | WP_275599281.1 |
Coordinates | 138999..139406 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | N0R80_RS20300 | Protein ID | WP_275599280.1 |
Coordinates | 139406..139660 (-) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0R80_RS20285 (N0R80_20285) | 135300..137663 | + | 2364 | WP_275600147.1 | EAL domain-containing protein | - |
N0R80_RS20290 (N0R80_20290) | 137729..138721 | - | 993 | WP_275599282.1 | inositol 2-dehydrogenase | - |
N0R80_RS20295 (N0R80_20295) | 138999..139406 | - | 408 | WP_275599281.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N0R80_RS20300 (N0R80_20300) | 139406..139660 | - | 255 | WP_275599280.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
N0R80_RS20305 (N0R80_20305) | 139874..140116 | + | 243 | WP_026168958.1 | hypothetical protein | - |
N0R80_RS20310 (N0R80_20310) | 140120..140572 | - | 453 | WP_275599279.1 | hypothetical protein | - |
N0R80_RS20315 (N0R80_20315) | 140637..141616 | - | 980 | Protein_148 | LysR family transcriptional regulator | - |
N0R80_RS20320 (N0R80_20320) | 141889..142956 | + | 1068 | WP_100670072.1 | sugar ABC transporter substrate-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | htpB | 1..1695765 | 1695765 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 14939.14 Da Isoelectric Point: 6.8818
>T257318 WP_275599281.1 NZ_CP104136:c139406-138999 [Sinorhizobium sp. C101]
MYLVDTNIVSEARRGTPQALSWLRSVDPLSIQLSALTLGEIMRGIALKQKSDPKAAAHLTEWLRKLRHDHGDRILPVTDQ
IAVEWGRIAAIRSRGDIDGLLAATAIVHDLILVTRNVRDFEDTGASVINPWETPA
MYLVDTNIVSEARRGTPQALSWLRSVDPLSIQLSALTLGEIMRGIALKQKSDPKAAAHLTEWLRKLRHDHGDRILPVTDQ
IAVEWGRIAAIRSRGDIDGLLAATAIVHDLILVTRNVRDFEDTGASVINPWETPA
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|