Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE(toxin) |
Location | 1458509..1459031 | Replicon | plasmid pC101a |
Accession | NZ_CP104135 | ||
Organism | Sinorhizobium sp. C101 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A2N8JTE7 |
Locus tag | N0R80_RS09895 | Protein ID | WP_018097784.1 |
Coordinates | 1458509..1458796 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A2N8JTF1 |
Locus tag | N0R80_RS09900 | Protein ID | WP_026168897.1 |
Coordinates | 1458786..1459031 (-) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0R80_RS09875 (N0R80_09875) | 1454746..1455063 | + | 318 | WP_018097788.1 | DUF2849 domain-containing protein | - |
N0R80_RS09880 (N0R80_09880) | 1455078..1456751 | + | 1674 | WP_100673926.1 | nitrite/sulfite reductase | - |
N0R80_RS09885 (N0R80_09885) | 1456769..1457269 | + | 501 | WP_275598024.1 | DUF934 domain-containing protein | - |
N0R80_RS09890 (N0R80_09890) | 1457414..1458226 | + | 813 | WP_018097785.1 | ferredoxin--NADP reductase | - |
N0R80_RS09895 (N0R80_09895) | 1458509..1458796 | - | 288 | WP_018097784.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N0R80_RS09900 (N0R80_09900) | 1458786..1459031 | - | 246 | WP_026168897.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
N0R80_RS09905 (N0R80_09905) | 1459269..1460045 | - | 777 | WP_100673924.1 | amino acid ABC transporter ATP-binding protein | - |
N0R80_RS09910 (N0R80_09910) | 1460063..1461217 | - | 1155 | WP_100673923.1 | amino acid ABC transporter permease | - |
N0R80_RS09915 (N0R80_09915) | 1461222..1462415 | - | 1194 | WP_275598023.1 | amino acid ABC transporter permease | - |
N0R80_RS09920 (N0R80_09920) | 1462520..1463545 | - | 1026 | WP_100673922.1 | amino acid ABC transporter substrate-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | kdsB / adeG / adeG / fliQ / flhA / icl / htpB / acpXL / tufA / tufA / kdsA / acpXL / pgm | 1..3521547 | 3521547 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11088.01 Da Isoelectric Point: 11.1450
>T257315 WP_018097784.1 NZ_CP104135:c1458796-1458509 [Sinorhizobium sp. C101]
MPYSLEFLPSARKEWDKLGATIRQQFVKKLRERLERPRIPSAALSGMPDHYKIKLRQLGYRLVYRVDDGTVIVLVVAVGK
RERGDVYNTMRARGR
MPYSLEFLPSARKEWDKLGATIRQQFVKKLRERLERPRIPSAALSGMPDHYKIKLRQLGYRLVYRVDDGTVIVLVVAVGK
RERGDVYNTMRARGR
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2N8JTE7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2N8JTF1 |