Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 396803..397479 | Replicon | plasmid pC101a |
Accession | NZ_CP104135 | ||
Organism | Sinorhizobium sp. C101 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | N0R80_RS04680 | Protein ID | WP_275596863.1 |
Coordinates | 397063..397479 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A2N8K0L2 |
Locus tag | N0R80_RS04675 | Protein ID | WP_018094055.1 |
Coordinates | 396803..397066 (+) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0R80_RS04645 (N0R80_04645) | 391867..393073 | + | 1207 | Protein_372 | MFS transporter | - |
N0R80_RS04650 (N0R80_04650) | 393070..393573 | - | 504 | WP_275599960.1 | TetR/AcrR family transcriptional regulator | - |
N0R80_RS04655 (N0R80_04655) | 393682..394449 | + | 768 | WP_275596865.1 | SDR family NAD(P)-dependent oxidoreductase | - |
N0R80_RS04660 (N0R80_04660) | 394470..394811 | + | 342 | WP_100670025.1 | carboxymuconolactone decarboxylase family protein | - |
N0R80_RS04665 (N0R80_04665) | 395244..395942 | - | 699 | WP_275596864.1 | TetR/AcrR family transcriptional regulator C-terminal domain-containing protein | - |
N0R80_RS04670 (N0R80_04670) | 396137..396625 | + | 489 | WP_100669718.1 | RidA family protein | - |
N0R80_RS04675 (N0R80_04675) | 396803..397066 | + | 264 | WP_018094055.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
N0R80_RS04680 (N0R80_04680) | 397063..397479 | + | 417 | WP_275596863.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N0R80_RS04685 (N0R80_04685) | 397476..398093 | + | 618 | WP_275596862.1 | hypothetical protein | - |
N0R80_RS04690 (N0R80_04690) | 398185..399330 | + | 1146 | WP_275596861.1 | alpha-hydroxy acid oxidase | - |
N0R80_RS04695 (N0R80_04695) | 399601..400071 | - | 471 | WP_275596860.1 | aminoacyl-tRNA deacylase | - |
N0R80_RS04700 (N0R80_04700) | 400255..400932 | - | 678 | WP_275596859.1 | isoprenylcysteine carboxylmethyltransferase family protein | - |
N0R80_RS04705 (N0R80_04705) | 401397..401828 | - | 432 | WP_100669711.1 | DUF1810 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | kdsB / adeG / adeG / fliQ / flhA / icl / htpB / acpXL / tufA / tufA / kdsA / acpXL / pgm | 1..3521547 | 3521547 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15391.92 Da Isoelectric Point: 8.9532
>T257313 WP_275596863.1 NZ_CP104135:397063-397479 [Sinorhizobium sp. C101]
MSLWMLDTKIAGHVIKGDRPEIIDRLVSLPITDIVVSSVTEGELLYGLAKRGYPRTLSERVRQFLLRVDVLPWNRTAARS
YGDLRAACEAKGAALAPLDMMIAAHAVAFDAVLVTRDRAFTRVAEPLKTDDWTDQKLK
MSLWMLDTKIAGHVIKGDRPEIIDRLVSLPITDIVVSSVTEGELLYGLAKRGYPRTLSERVRQFLLRVDVLPWNRTAARS
YGDLRAACEAKGAALAPLDMMIAAHAVAFDAVLVTRDRAFTRVAEPLKTDDWTDQKLK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|