Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 1493759..1494429 | Replicon | plasmid pK101c |
| Accession | NZ_CP104133 | ||
| Organism | Sinorhizobium sp. K101 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | N0Q91_RS30330 | Protein ID | WP_275599104.1 |
| Coordinates | 1493759..1494205 (-) | Length | 149 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | N0Q91_RS30335 | Protein ID | WP_080636789.1 |
| Coordinates | 1494202..1494429 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N0Q91_RS30310 (N0Q91_30335) | 1489665..1491446 | - | 1782 | WP_275599102.1 | monovalent cation:proton antiporter-2 (CPA2) family protein | - |
| N0Q91_RS30315 (N0Q91_30340) | 1491651..1492439 | - | 789 | WP_018099177.1 | SDR family oxidoreductase | - |
| N0Q91_RS30320 (N0Q91_30345) | 1492436..1492762 | - | 327 | WP_102763395.1 | nuclear transport factor 2 family protein | - |
| N0Q91_RS30325 (N0Q91_30350) | 1492857..1493762 | + | 906 | WP_275599103.1 | LysR family transcriptional regulator | - |
| N0Q91_RS30330 (N0Q91_30355) | 1493759..1494205 | - | 447 | WP_275599104.1 | PIN domain-containing protein | Toxin |
| N0Q91_RS30335 (N0Q91_30360) | 1494202..1494429 | - | 228 | WP_080636789.1 | CopG family transcriptional regulator | Antitoxin |
| N0Q91_RS30340 (N0Q91_30365) | 1495034..1496461 | - | 1428 | WP_275596165.1 | ISNCY family transposase | - |
| N0Q91_RS30345 (N0Q91_30370) | 1496928..1497605 | - | 678 | WP_275599105.1 | hypothetical protein | - |
| N0Q91_RS30350 (N0Q91_30375) | 1497987..1499201 | - | 1215 | WP_275599106.1 | YeeE/YedE family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | htpB | 1..1695711 | 1695711 | |
| - | flank | IS/Tn | - | - | 1495034..1496461 | 1427 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 149 a.a. Molecular weight: 15668.94 Da Isoelectric Point: 7.4219
>T257311 WP_275599104.1 NZ_CP104133:c1494205-1493759 [Sinorhizobium sp. K101]
VTFLLDVNVLIALIDPGHVAHDDAHEWFAATGQTAWATCPITENGVIRIVGNPKYPNSPGSPSLVMEIVGKMRSLPGHSF
WPDDVSLVGSGDIAPTKILTSGQVTDTYLLALAKARGGQLATFDRKLSAAAVTRGNSALHLITATRVR
VTFLLDVNVLIALIDPGHVAHDDAHEWFAATGQTAWATCPITENGVIRIVGNPKYPNSPGSPSLVMEIVGKMRSLPGHSF
WPDDVSLVGSGDIAPTKILTSGQVTDTYLLALAKARGGQLATFDRKLSAAAVTRGNSALHLITATRVR
Download Length: 447 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|