Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1395366..1396173 | Replicon | plasmid pK101c |
Accession | NZ_CP104133 | ||
Organism | Sinorhizobium sp. K101 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | - |
Locus tag | N0Q91_RS29865 | Protein ID | WP_100670374.1 |
Coordinates | 1395366..1395890 (-) | Length | 175 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | A0A2N8JWE8 |
Locus tag | N0Q91_RS29870 | Protein ID | WP_018097027.1 |
Coordinates | 1395883..1396173 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0Q91_RS29840 (N0Q91_29865) | 1390466..1391323 | + | 858 | WP_100670384.1 | carbohydrate ABC transporter permease | - |
N0Q91_RS29845 (N0Q91_29870) | 1391352..1392581 | + | 1230 | WP_275599048.1 | extracellular solute-binding protein | - |
N0Q91_RS29850 (N0Q91_29875) | 1392670..1393800 | + | 1131 | WP_275599049.1 | sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC | - |
N0Q91_RS29855 (N0Q91_29880) | 1393803..1394303 | + | 501 | WP_275599050.1 | GNAT family N-acetyltransferase | - |
N0Q91_RS29860 (N0Q91_29885) | 1394451..1394834 | + | 384 | WP_102762399.1 | VOC family protein | - |
N0Q91_RS29865 (N0Q91_29890) | 1395366..1395890 | - | 525 | WP_100670374.1 | GNAT family N-acetyltransferase | Toxin |
N0Q91_RS29870 (N0Q91_29895) | 1395883..1396173 | - | 291 | WP_018097027.1 | DUF1778 domain-containing protein | Antitoxin |
N0Q91_RS29875 (N0Q91_29900) | 1396316..1396573 | - | 258 | WP_018097026.1 | hypothetical protein | - |
N0Q91_RS29880 (N0Q91_29905) | 1396593..1397168 | - | 576 | WP_275599051.1 | thermonuclease family protein | - |
N0Q91_RS29885 (N0Q91_29910) | 1397543..1399027 | - | 1485 | WP_275599052.1 | succinoglycan biosynthesis transport protein ExoT | - |
N0Q91_RS29890 (N0Q91_29915) | 1399151..1400108 | + | 958 | Protein_1312 | succinoglycan biosynthesis glycosyltransferase ExoW | - |
N0Q91_RS29895 (N0Q91_29920) | 1400223..1401173 | + | 951 | WP_275599053.1 | succinoglycan biosynthesis protein ExoV | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | htpB | 1..1695711 | 1695711 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 175 a.a. Molecular weight: 18532.30 Da Isoelectric Point: 7.3207
>T257310 WP_100670374.1 NZ_CP104133:c1395890-1395366 [Sinorhizobium sp. K101]
VLDWREEPIGRHHDRKAFDCGTPELNEYLRRHARQNHEGGGSKTFVAVAPTAPETILGYYSISPASIAFAKVPAPLTKGL
GRYEVAVYRLARLAVALPLQGRGLGGDLLLAAGARALAVAAQVGGVALAIDAKDEKAACWYERFGAMPLLDSSPLSLILP
FKTIIDALDAAQGE
VLDWREEPIGRHHDRKAFDCGTPELNEYLRRHARQNHEGGGSKTFVAVAPTAPETILGYYSISPASIAFAKVPAPLTKGL
GRYEVAVYRLARLAVALPLQGRGLGGDLLLAAGARALAVAAQVGGVALAIDAKDEKAACWYERFGAMPLLDSSPLSLILP
FKTIIDALDAAQGE
Download Length: 525 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|