Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-Phd |
| Location | 123868..124529 | Replicon | plasmid pK101c |
| Accession | NZ_CP104133 | ||
| Organism | Sinorhizobium sp. K101 | ||
Toxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | N0Q91_RS23880 | Protein ID | WP_275599281.1 |
| Coordinates | 124122..124529 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | N0Q91_RS23875 | Protein ID | WP_275599280.1 |
| Coordinates | 123868..124122 (+) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N0Q91_RS23855 (N0Q91_23880) | 120572..121639 | - | 1068 | WP_100670072.1 | sugar ABC transporter substrate-binding protein | - |
| N0Q91_RS23860 (N0Q91_23885) | 121912..122891 | + | 980 | Protein_108 | LysR family transcriptional regulator | - |
| N0Q91_RS23865 (N0Q91_23890) | 122956..123408 | + | 453 | WP_275599279.1 | hypothetical protein | - |
| N0Q91_RS23870 (N0Q91_23895) | 123412..123654 | - | 243 | WP_026168958.1 | hypothetical protein | - |
| N0Q91_RS23875 (N0Q91_23900) | 123868..124122 | + | 255 | WP_275599280.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| N0Q91_RS23880 (N0Q91_23905) | 124122..124529 | + | 408 | WP_275599281.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| N0Q91_RS23885 (N0Q91_23910) | 124807..125799 | + | 993 | WP_275599282.1 | inositol 2-dehydrogenase | - |
| N0Q91_RS23890 (N0Q91_23915) | 125865..128229 | - | 2365 | Protein_114 | EAL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | htpB | 1..1695711 | 1695711 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 14939.14 Da Isoelectric Point: 6.8818
>T257308 WP_275599281.1 NZ_CP104133:124122-124529 [Sinorhizobium sp. K101]
MYLVDTNIVSEARRGTPQALSWLRSVDPLSIQLSALTLGEIMRGIALKQKSDPKAAAHLTEWLRKLRHDHGDRILPVTDQ
IAVEWGRIAAIRSRGDIDGLLAATAIVHDLILVTRNVRDFEDTGASVINPWETPA
MYLVDTNIVSEARRGTPQALSWLRSVDPLSIQLSALTLGEIMRGIALKQKSDPKAAAHLTEWLRKLRHDHGDRILPVTDQ
IAVEWGRIAAIRSRGDIDGLLAATAIVHDLILVTRNVRDFEDTGASVINPWETPA
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|