Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 367956..368626 | Replicon | plasmid pK101b |
Accession | NZ_CP104132 | ||
Organism | Sinorhizobium sp. K101 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | N0Q91_RS21355 | Protein ID | WP_275598668.1 |
Coordinates | 368207..368626 (+) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | N0Q91_RS21350 | Protein ID | WP_275598667.1 |
Coordinates | 367956..368210 (+) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0Q91_RS21330 (N0Q91_21340) | 364138..365073 | + | 936 | WP_275598663.1 | ABC transporter permease | - |
N0Q91_RS21335 (N0Q91_21345) | 365079..365900 | + | 822 | WP_275598664.1 | ABC transporter permease | - |
N0Q91_RS21340 (N0Q91_21350) | 365897..366808 | + | 912 | WP_275598665.1 | ABC transporter ATP-binding protein | - |
N0Q91_RS21345 (N0Q91_21355) | 366805..367767 | + | 963 | WP_275598666.1 | ATP-binding cassette domain-containing protein | - |
N0Q91_RS21350 (N0Q91_21360) | 367956..368210 | + | 255 | WP_275598667.1 | plasmid stabilization protein | Antitoxin |
N0Q91_RS21355 (N0Q91_21365) | 368207..368626 | + | 420 | WP_275598668.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N0Q91_RS21360 (N0Q91_21370) | 368795..369202 | - | 408 | WP_275598669.1 | GFA family protein | - |
N0Q91_RS21365 (N0Q91_21375) | 369598..372132 | + | 2535 | WP_275598689.1 | PAS domain S-box protein | - |
N0Q91_RS21370 (N0Q91_21380) | 372159..372521 | + | 363 | WP_275598670.1 | response regulator | - |
N0Q91_RS21375 (N0Q91_21385) | 372604..373521 | + | 918 | WP_275598671.1 | DnaJ C-terminal domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..772620 | 772620 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 14859.15 Da Isoelectric Point: 5.7116
>T257307 WP_275598668.1 NZ_CP104132:368207-368626 [Sinorhizobium sp. K101]
MIVLDTNVVSEVMKPAADPAVRSWLNEQVAETLYLASVTLAELLFGIGALPDGRRKKALAEMFDGVLELFGDRVLPFDIG
AARYYAGLAVTARAAGKGFPTPDGYIAAIAASRGFLVATRDISPFEAAGLTVVNPWHHR
MIVLDTNVVSEVMKPAADPAVRSWLNEQVAETLYLASVTLAELLFGIGALPDGRRKKALAEMFDGVLELFGDRVLPFDIG
AARYYAGLAVTARAAGKGFPTPDGYIAAIAASRGFLVATRDISPFEAAGLTVVNPWHHR
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|