Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 240138..240718 | Replicon | plasmid pK101b |
Accession | NZ_CP104132 | ||
Organism | Sinorhizobium sp. K101 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | N0Q91_RS20765 | Protein ID | WP_275598578.1 |
Coordinates | 240335..240718 (+) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | N0Q91_RS20760 | Protein ID | WP_275598577.1 |
Coordinates | 240138..240338 (+) | Length | 67 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0Q91_RS20740 (N0Q91_20750) | 235975..236772 | + | 798 | WP_275598573.1 | ABC transporter ATP-binding protein | - |
N0Q91_RS20745 (N0Q91_20755) | 236744..237445 | - | 702 | WP_275598574.1 | class I SAM-dependent methyltransferase | - |
N0Q91_RS20750 (N0Q91_20760) | 237810..238535 | - | 726 | WP_275598575.1 | calcium-binding protein | - |
N0Q91_RS20755 (N0Q91_20765) | 238472..239758 | - | 1287 | WP_275598576.1 | calcium-binding protein | - |
N0Q91_RS20760 (N0Q91_20770) | 240138..240338 | + | 201 | WP_275598577.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
N0Q91_RS20765 (N0Q91_20775) | 240335..240718 | + | 384 | WP_275598578.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N0Q91_RS20770 (N0Q91_20780) | 240811..241200 | - | 390 | WP_102761961.1 | ester cyclase | - |
N0Q91_RS20775 (N0Q91_20785) | 241542..241964 | - | 423 | WP_275598579.1 | type II toxin-antitoxin system VapC family toxin | - |
N0Q91_RS20780 (N0Q91_20790) | 241961..242215 | - | 255 | WP_275598580.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
N0Q91_RS20785 (N0Q91_20795) | 242367..242987 | - | 621 | WP_275598581.1 | hypothetical protein | - |
N0Q91_RS20790 (N0Q91_20800) | 244030..244503 | - | 474 | WP_018096595.1 | MarR family transcriptional regulator | - |
N0Q91_RS20795 (N0Q91_20805) | 244765..245178 | - | 414 | WP_275598582.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..772620 | 772620 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14269.53 Da Isoelectric Point: 7.5964
>T257306 WP_275598578.1 NZ_CP104132:240335-240718 [Sinorhizobium sp. K101]
VILADTSIWIDHFRHTDAELRRIVEDDRLLCHPAVIGELALGSLRERSSVIAFLMAQREALVATHHEVMMMVDRHAIFSM
GIGYTDAHLLASVLLDKRVALWTRDKRLRAAAEKAGASLHTPAHTRN
VILADTSIWIDHFRHTDAELRRIVEDDRLLCHPAVIGELALGSLRERSSVIAFLMAQREALVATHHEVMMMVDRHAIFSM
GIGYTDAHLLASVLLDKRVALWTRDKRLRAAAEKAGASLHTPAHTRN
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|