Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-RelB |
| Location | 170695..171293 | Replicon | plasmid pK101b |
| Accession | NZ_CP104132 | ||
| Organism | Sinorhizobium sp. K101 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | Q930F0 |
| Locus tag | N0Q91_RS20435 | Protein ID | WP_010967243.1 |
| Coordinates | 170695..170988 (-) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | N0Q91_RS20440 | Protein ID | WP_275598527.1 |
| Coordinates | 170985..171293 (-) | Length | 103 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N0Q91_RS20405 (N0Q91_20415) | 166201..166443 | + | 243 | WP_275598523.1 | hypothetical protein | - |
| N0Q91_RS20410 (N0Q91_20420) | 166492..166587 | + | 96 | Protein_168 | cold-shock protein | - |
| N0Q91_RS20415 (N0Q91_20425) | 166845..167237 | - | 393 | WP_275598524.1 | response regulator | - |
| N0Q91_RS20420 (N0Q91_20430) | 167445..168575 | - | 1131 | WP_275598525.1 | IS1595 family transposase | - |
| N0Q91_RS20425 (N0Q91_20435) | 168743..169044 | - | 302 | Protein_171 | plasmid partitioning protein RepB C-terminal domain-containing protein | - |
| N0Q91_RS20430 (N0Q91_20440) | 169235..170434 | + | 1200 | WP_275598526.1 | NAD-dependent formate dehydrogenase | - |
| N0Q91_RS20435 (N0Q91_20445) | 170695..170988 | - | 294 | WP_010967243.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | Toxin |
| N0Q91_RS20440 (N0Q91_20450) | 170985..171293 | - | 309 | WP_275598527.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| N0Q91_RS20445 (N0Q91_20455) | 171499..171927 | - | 429 | WP_275598528.1 | GNAT family N-acetyltransferase | - |
| N0Q91_RS20450 (N0Q91_20460) | 172940..173056 | - | 117 | Protein_176 | cation transporter | - |
| N0Q91_RS20455 (N0Q91_20465) | 173255..173788 | + | 534 | Protein_177 | short-chain dehydrogenase | - |
| N0Q91_RS20460 (N0Q91_20470) | 173973..174200 | - | 228 | WP_003525968.1 | hypothetical protein | - |
| N0Q91_RS20465 (N0Q91_20475) | 174277..175170 | - | 894 | WP_275598529.1 | AraC family transcriptional regulator | - |
| N0Q91_RS20470 (N0Q91_20480) | 175383..175784 | - | 402 | WP_275598530.1 | periplasmic heavy metal sensor | - |
| N0Q91_RS20475 (N0Q91_20485) | 175781..176230 | - | 450 | WP_275598531.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..772620 | 772620 | |
| - | flank | IS/Tn | - | - | 167445..168575 | 1130 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11278.93 Da Isoelectric Point: 6.4734
>T257305 WP_010967243.1 NZ_CP104132:c170988-170695 [Sinorhizobium sp. K101]
MRLVWARYALDDRDTIFSYIERENPRAAVHVDEEIVSAVRRLLDFPESGRPGRIAGTRELVIPRTPYIAAYMVMEDRIRI
LRVLHGAQKWPSELDDG
MRLVWARYALDDRDTIFSYIERENPRAAVHVDEEIVSAVRRLLDFPESGRPGRIAGTRELVIPRTPYIAAYMVMEDRIRI
LRVLHGAQKWPSELDDG
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|