Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 2680782..2681458 Replicon plasmid pK101a
Accession NZ_CP104131
Organism Sinorhizobium sp. K101

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag N0Q91_RS15610 Protein ID WP_275596863.1
Coordinates 2680782..2681198 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A2N8K0L2
Locus tag N0Q91_RS15615 Protein ID WP_018094055.1
Coordinates 2681195..2681458 (-) Length 88 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N0Q91_RS15585 (N0Q91_15595) 2676433..2676864 + 432 WP_100669711.1 DUF1810 domain-containing protein -
N0Q91_RS15590 (N0Q91_15600) 2677329..2678006 + 678 WP_275596859.1 isoprenylcysteine carboxylmethyltransferase family protein -
N0Q91_RS15595 (N0Q91_15605) 2678190..2678660 + 471 WP_275596860.1 aminoacyl-tRNA deacylase -
N0Q91_RS15600 (N0Q91_15610) 2678931..2680076 - 1146 WP_275596861.1 alpha-hydroxy acid oxidase -
N0Q91_RS15605 (N0Q91_15615) 2680168..2680785 - 618 WP_275596862.1 hypothetical protein -
N0Q91_RS15610 (N0Q91_15620) 2680782..2681198 - 417 WP_275596863.1 type II toxin-antitoxin system VapC family toxin Toxin
N0Q91_RS15615 (N0Q91_15625) 2681195..2681458 - 264 WP_018094055.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
N0Q91_RS15620 (N0Q91_15630) 2681636..2682124 - 489 WP_100669718.1 RidA family protein -
N0Q91_RS15625 (N0Q91_15635) 2682319..2683017 + 699 WP_275596864.1 TetR/AcrR family transcriptional regulator C-terminal domain-containing protein -
N0Q91_RS15630 (N0Q91_15640) 2683450..2683791 - 342 WP_100670025.1 carboxymuconolactone decarboxylase family protein -
N0Q91_RS15635 (N0Q91_15645) 2683812..2684579 - 768 WP_275596865.1 SDR family NAD(P)-dependent oxidoreductase -
N0Q91_RS15640 (N0Q91_15650) 2684688..2685190 + 503 Protein_2539 TetR/AcrR family transcriptional regulator -
N0Q91_RS15645 (N0Q91_15655) 2685187..2686392 - 1206 WP_275596866.1 MFS transporter -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - pgm / acpXL / kdsA / tufA / tufA / acpXL / htpB / icl / fliQ / adeG / kdsB 1..3521393 3521393


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-125)

Antitoxin

SpoVT-AbrB domain

(11-54)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15391.92 Da        Isoelectric Point: 8.9532

>T257303 WP_275596863.1 NZ_CP104131:c2681198-2680782 [Sinorhizobium sp. K101]
MSLWMLDTKIAGHVIKGDRPEIIDRLVSLPITDIVVSSVTEGELLYGLAKRGYPRTLSERVRQFLLRVDVLPWNRTAARS
YGDLRAACEAKGAALAPLDMMIAAHAVAFDAVLVTRDRAFTRVAEPLKTDDWTDQKLK

Download         Length: 417 bp

Antitoxin


Download         Length: 88 a.a.        Molecular weight: 9846.96 Da        Isoelectric Point: 5.1708

>AT257303 WP_018094055.1 NZ_CP104131:c2681458-2681195 [Sinorhizobium sp. K101]
VATKTAKIFASGRSQAVRLPAEFRFEGSEVFVRRDPKTGDVILSRKPDSWDGLFELYGKDQVGDDFLGPADRKQPSQDRD
PFEGWKE

Download         Length: 264 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A2N8K0L2

References