Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 2680782..2681458 | Replicon | plasmid pK101a |
| Accession | NZ_CP104131 | ||
| Organism | Sinorhizobium sp. K101 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | N0Q91_RS15610 | Protein ID | WP_275596863.1 |
| Coordinates | 2680782..2681198 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A2N8K0L2 |
| Locus tag | N0Q91_RS15615 | Protein ID | WP_018094055.1 |
| Coordinates | 2681195..2681458 (-) | Length | 88 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | pgm / acpXL / kdsA / tufA / tufA / acpXL / htpB / icl / fliQ / adeG / kdsB | 1..3521393 | 3521393 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15391.92 Da Isoelectric Point: 8.9532
>T257303 WP_275596863.1 NZ_CP104131:c2681198-2680782 [Sinorhizobium sp. K101]
MSLWMLDTKIAGHVIKGDRPEIIDRLVSLPITDIVVSSVTEGELLYGLAKRGYPRTLSERVRQFLLRVDVLPWNRTAARS
YGDLRAACEAKGAALAPLDMMIAAHAVAFDAVLVTRDRAFTRVAEPLKTDDWTDQKLK
MSLWMLDTKIAGHVIKGDRPEIIDRLVSLPITDIVVSSVTEGELLYGLAKRGYPRTLSERVRQFLLRVDVLPWNRTAARS
YGDLRAACEAKGAALAPLDMMIAAHAVAFDAVLVTRDRAFTRVAEPLKTDDWTDQKLK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|