Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE(toxin) |
Location | 1619266..1619788 | Replicon | plasmid pK101a |
Accession | NZ_CP104131 | ||
Organism | Sinorhizobium sp. K101 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A2N8JTE7 |
Locus tag | N0Q91_RS10385 | Protein ID | WP_018097784.1 |
Coordinates | 1619501..1619788 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A2N8JTF1 |
Locus tag | N0Q91_RS10380 | Protein ID | WP_026168897.1 |
Coordinates | 1619266..1619511 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0Q91_RS10360 (N0Q91_10370) | 1614753..1615778 | + | 1026 | WP_100673922.1 | amino acid ABC transporter substrate-binding protein | - |
N0Q91_RS10365 (N0Q91_10375) | 1615883..1617076 | + | 1194 | WP_275598023.1 | amino acid ABC transporter permease | - |
N0Q91_RS10370 (N0Q91_10380) | 1617081..1618235 | + | 1155 | WP_100673923.1 | amino acid ABC transporter permease | - |
N0Q91_RS10375 (N0Q91_10385) | 1618252..1619028 | + | 777 | WP_100673924.1 | amino acid ABC transporter ATP-binding protein | - |
N0Q91_RS10380 (N0Q91_10390) | 1619266..1619511 | + | 246 | WP_026168897.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
N0Q91_RS10385 (N0Q91_10395) | 1619501..1619788 | + | 288 | WP_018097784.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N0Q91_RS10390 (N0Q91_10400) | 1620070..1620882 | - | 813 | WP_018097785.1 | ferredoxin--NADP reductase | - |
N0Q91_RS10395 (N0Q91_10405) | 1621027..1621527 | - | 501 | WP_275598024.1 | DUF934 domain-containing protein | - |
N0Q91_RS10400 (N0Q91_10410) | 1621545..1623218 | - | 1674 | WP_100673926.1 | nitrite/sulfite reductase | - |
N0Q91_RS10405 (N0Q91_10415) | 1623233..1623550 | - | 318 | WP_018097788.1 | DUF2849 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | pgm / acpXL / kdsA / tufA / tufA / acpXL / htpB / icl / fliQ / adeG / kdsB | 1..3521393 | 3521393 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11088.01 Da Isoelectric Point: 11.1450
>T257301 WP_018097784.1 NZ_CP104131:1619501-1619788 [Sinorhizobium sp. K101]
MPYSLEFLPSARKEWDKLGATIRQQFVKKLRERLERPRIPSAALSGMPDHYKIKLRQLGYRLVYRVDDGTVIVLVVAVGK
RERGDVYNTMRARGR
MPYSLEFLPSARKEWDKLGATIRQQFVKKLRERLERPRIPSAALSGMPDHYKIKLRQLGYRLVYRVDDGTVIVLVVAVGK
RERGDVYNTMRARGR
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2N8JTE7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2N8JTF1 |