Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-Phd |
| Location | 562464..563125 | Replicon | plasmid pM103c |
| Accession | NZ_CP104129 | ||
| Organism | Sinorhizobium sp. M103 | ||
Toxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | N0Q90_RS25905 | Protein ID | WP_275599281.1 |
| Coordinates | 562718..563125 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | N0Q90_RS25900 | Protein ID | WP_275599280.1 |
| Coordinates | 562464..562718 (+) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N0Q90_RS25880 (N0Q90_25885) | 559167..560234 | - | 1068 | WP_100670072.1 | sugar ABC transporter substrate-binding protein | - |
| N0Q90_RS25885 (N0Q90_25890) | 560507..561486 | + | 980 | Protein_501 | LysR family transcriptional regulator | - |
| N0Q90_RS25890 (N0Q90_25895) | 561551..562003 | + | 453 | WP_275599279.1 | hypothetical protein | - |
| N0Q90_RS25895 (N0Q90_25900) | 562007..562249 | - | 243 | WP_026168958.1 | hypothetical protein | - |
| N0Q90_RS25900 (N0Q90_25905) | 562464..562718 | + | 255 | WP_275599280.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| N0Q90_RS25905 (N0Q90_25910) | 562718..563125 | + | 408 | WP_275599281.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| N0Q90_RS25910 (N0Q90_25915) | 563403..564395 | + | 993 | WP_275599282.1 | inositol 2-dehydrogenase | - |
| N0Q90_RS25915 (N0Q90_25920) | 564461..566824 | - | 2364 | Protein_507 | EAL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | htpB | 1..1695771 | 1695771 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 14939.14 Da Isoelectric Point: 6.8818
>T257297 WP_275599281.1 NZ_CP104129:562718-563125 [Sinorhizobium sp. M103]
MYLVDTNIVSEARRGTPQALSWLRSVDPLSIQLSALTLGEIMRGIALKQKSDPKAAAHLTEWLRKLRHDHGDRILPVTDQ
IAVEWGRIAAIRSRGDIDGLLAATAIVHDLILVTRNVRDFEDTGASVINPWETPA
MYLVDTNIVSEARRGTPQALSWLRSVDPLSIQLSALTLGEIMRGIALKQKSDPKAAAHLTEWLRKLRHDHGDRILPVTDQ
IAVEWGRIAAIRSRGDIDGLLAATAIVHDLILVTRNVRDFEDTGASVINPWETPA
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|