Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 236622..237292 | Replicon | plasmid pM103c |
| Accession | NZ_CP104129 | ||
| Organism | Sinorhizobium sp. M103 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | N0Q90_RS24455 | Protein ID | WP_275599104.1 |
| Coordinates | 236622..237068 (-) | Length | 149 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | N0Q90_RS24460 | Protein ID | WP_080636789.1 |
| Coordinates | 237065..237292 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N0Q90_RS24435 (N0Q90_24440) | 232528..234309 | - | 1782 | WP_275599102.1 | monovalent cation:proton antiporter-2 (CPA2) family protein | - |
| N0Q90_RS24440 (N0Q90_24445) | 234514..235302 | - | 789 | WP_018099177.1 | SDR family oxidoreductase | - |
| N0Q90_RS24445 (N0Q90_24450) | 235299..235625 | - | 327 | WP_102763395.1 | nuclear transport factor 2 family protein | - |
| N0Q90_RS24450 (N0Q90_24455) | 235720..236625 | + | 906 | WP_275599103.1 | LysR family transcriptional regulator | - |
| N0Q90_RS24455 (N0Q90_24460) | 236622..237068 | - | 447 | WP_275599104.1 | PIN domain-containing protein | Toxin |
| N0Q90_RS24460 (N0Q90_24465) | 237065..237292 | - | 228 | WP_080636789.1 | CopG family transcriptional regulator | Antitoxin |
| N0Q90_RS24465 (N0Q90_24470) | 237897..239324 | - | 1428 | WP_275596165.1 | ISNCY family transposase | - |
| N0Q90_RS24470 (N0Q90_24475) | 239791..240468 | - | 678 | WP_275599105.1 | hypothetical protein | - |
| N0Q90_RS24475 (N0Q90_24480) | 240850..242065 | - | 1216 | Protein_219 | YeeE/YedE family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | htpB | 1..1695771 | 1695771 | |
| - | flank | IS/Tn | - | - | 237897..239324 | 1427 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 149 a.a. Molecular weight: 15668.94 Da Isoelectric Point: 7.4219
>T257296 WP_275599104.1 NZ_CP104129:c237068-236622 [Sinorhizobium sp. M103]
VTFLLDVNVLIALIDPGHVAHDDAHEWFAATGQTAWATCPITENGVIRIVGNPKYPNSPGSPSLVMEIVGKMRSLPGHSF
WPDDVSLVGSGDIAPTKILTSGQVTDTYLLALAKARGGQLATFDRKLSAAAVTRGNSALHLITATRVR
VTFLLDVNVLIALIDPGHVAHDDAHEWFAATGQTAWATCPITENGVIRIVGNPKYPNSPGSPSLVMEIVGKMRSLPGHSF
WPDDVSLVGSGDIAPTKILTSGQVTDTYLLALAKARGGQLATFDRKLSAAAVTRGNSALHLITATRVR
Download Length: 447 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|