Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 138228..139035 | Replicon | plasmid pM103c |
Accession | NZ_CP104129 | ||
Organism | Sinorhizobium sp. M103 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | - |
Locus tag | N0Q90_RS23990 | Protein ID | WP_100670374.1 |
Coordinates | 138228..138752 (-) | Length | 175 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | A0A2N8JWE8 |
Locus tag | N0Q90_RS23995 | Protein ID | WP_018097027.1 |
Coordinates | 138745..139035 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0Q90_RS23965 (N0Q90_23970) | 133328..134185 | + | 858 | WP_100670384.1 | carbohydrate ABC transporter permease | - |
N0Q90_RS23970 (N0Q90_23975) | 134214..135442 | + | 1229 | Protein_118 | extracellular solute-binding protein | - |
N0Q90_RS23975 (N0Q90_23980) | 135531..136661 | + | 1131 | WP_275599049.1 | sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC | - |
N0Q90_RS23980 (N0Q90_23985) | 136664..137164 | + | 501 | WP_275599050.1 | GNAT family N-acetyltransferase | - |
N0Q90_RS23985 (N0Q90_23990) | 137312..137695 | + | 384 | WP_102762399.1 | VOC family protein | - |
N0Q90_RS23990 (N0Q90_23995) | 138228..138752 | - | 525 | WP_100670374.1 | GNAT family N-acetyltransferase | Toxin |
N0Q90_RS23995 (N0Q90_24000) | 138745..139035 | - | 291 | WP_018097027.1 | DUF1778 domain-containing protein | Antitoxin |
N0Q90_RS24000 (N0Q90_24005) | 139178..139435 | - | 258 | WP_018097026.1 | hypothetical protein | - |
N0Q90_RS24005 (N0Q90_24010) | 139455..140030 | - | 576 | WP_275599051.1 | thermonuclease family protein | - |
N0Q90_RS24010 (N0Q90_24015) | 140405..141889 | - | 1485 | WP_275602749.1 | succinoglycan biosynthesis transport protein ExoT | - |
N0Q90_RS24015 (N0Q90_24020) | 142013..142970 | + | 958 | Protein_127 | succinoglycan biosynthesis glycosyltransferase ExoW | - |
N0Q90_RS24020 (N0Q90_24025) | 143085..144035 | + | 951 | WP_275599053.1 | succinoglycan biosynthesis protein ExoV | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | htpB | 1..1695771 | 1695771 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 175 a.a. Molecular weight: 18532.30 Da Isoelectric Point: 7.3207
>T257295 WP_100670374.1 NZ_CP104129:c138752-138228 [Sinorhizobium sp. M103]
VLDWREEPIGRHHDRKAFDCGTPELNEYLRRHARQNHEGGGSKTFVAVAPTAPETILGYYSISPASIAFAKVPAPLTKGL
GRYEVAVYRLARLAVALPLQGRGLGGDLLLAAGARALAVAAQVGGVALAIDAKDEKAACWYERFGAMPLLDSSPLSLILP
FKTIIDALDAAQGE
VLDWREEPIGRHHDRKAFDCGTPELNEYLRRHARQNHEGGGSKTFVAVAPTAPETILGYYSISPASIAFAKVPAPLTKGL
GRYEVAVYRLARLAVALPLQGRGLGGDLLLAAGARALAVAAQVGGVALAIDAKDEKAACWYERFGAMPLLDSSPLSLILP
FKTIIDALDAAQGE
Download Length: 525 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|