Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 587569..588239 | Replicon | plasmid pM103b |
Accession | NZ_CP104128 | ||
Organism | Sinorhizobium sp. M103 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | N0Q90_RS22485 | Protein ID | WP_275598668.1 |
Coordinates | 587820..588239 (+) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | N0Q90_RS22480 | Protein ID | WP_275598667.1 |
Coordinates | 587569..587823 (+) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0Q90_RS22460 (N0Q90_22465) | 583751..584686 | + | 936 | WP_275598663.1 | ABC transporter permease | - |
N0Q90_RS22465 (N0Q90_22470) | 584692..585513 | + | 822 | WP_275598664.1 | ABC transporter permease | - |
N0Q90_RS22470 (N0Q90_22475) | 585510..586421 | + | 912 | WP_275598665.1 | ABC transporter ATP-binding protein | - |
N0Q90_RS22475 (N0Q90_22480) | 586418..587380 | + | 963 | WP_275598666.1 | ATP-binding cassette domain-containing protein | - |
N0Q90_RS22480 (N0Q90_22485) | 587569..587823 | + | 255 | WP_275598667.1 | plasmid stabilization protein | Antitoxin |
N0Q90_RS22485 (N0Q90_22490) | 587820..588239 | + | 420 | WP_275598668.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N0Q90_RS22490 (N0Q90_22495) | 588408..588815 | - | 408 | WP_275598669.1 | GFA family protein | - |
N0Q90_RS22495 (N0Q90_22500) | 589211..591745 | + | 2535 | WP_275598689.1 | PAS domain S-box protein | - |
N0Q90_RS22500 (N0Q90_22505) | 591772..592134 | + | 363 | WP_275598670.1 | response regulator | - |
N0Q90_RS22505 (N0Q90_22510) | 592217..593134 | + | 918 | WP_275598671.1 | DnaJ C-terminal domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..772647 | 772647 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 14859.15 Da Isoelectric Point: 5.7116
>T257294 WP_275598668.1 NZ_CP104128:587820-588239 [Sinorhizobium sp. M103]
MIVLDTNVVSEVMKPAADPAVRSWLNEQVAETLYLASVTLAELLFGIGALPDGRRKKALAEMFDGVLELFGDRVLPFDIG
AARYYAGLAVTARAAGKGFPTPDGYIAAIAASRGFLVATRDISPFEAAGLTVVNPWHHR
MIVLDTNVVSEVMKPAADPAVRSWLNEQVAETLYLASVTLAELLFGIGALPDGRRKKALAEMFDGVLELFGDRVLPFDIG
AARYYAGLAVTARAAGKGFPTPDGYIAAIAASRGFLVATRDISPFEAAGLTVVNPWHHR
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|