Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 459750..460330 | Replicon | plasmid pM103b |
Accession | NZ_CP104128 | ||
Organism | Sinorhizobium sp. M103 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | N0Q90_RS21890 | Protein ID | WP_275598578.1 |
Coordinates | 459947..460330 (+) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | N0Q90_RS21885 | Protein ID | WP_275598577.1 |
Coordinates | 459750..459950 (+) | Length | 67 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0Q90_RS21870 (N0Q90_21875) | 455586..456383 | + | 798 | WP_275598573.1 | ABC transporter ATP-binding protein | - |
N0Q90_RS21875 (N0Q90_21880) | 456355..457056 | - | 702 | WP_275598574.1 | class I SAM-dependent methyltransferase | - |
N0Q90_RS21880 (N0Q90_21885) | 457421..459370 | - | 1950 | WP_275602654.1 | calcium-binding protein | - |
N0Q90_RS21885 (N0Q90_21890) | 459750..459950 | + | 201 | WP_275598577.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
N0Q90_RS21890 (N0Q90_21895) | 459947..460330 | + | 384 | WP_275598578.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N0Q90_RS21895 (N0Q90_21900) | 460423..460812 | - | 390 | WP_102761961.1 | ester cyclase | - |
N0Q90_RS21900 (N0Q90_21905) | 461154..461576 | - | 423 | WP_275598579.1 | type II toxin-antitoxin system VapC family toxin | - |
N0Q90_RS21905 (N0Q90_21910) | 461573..461827 | - | 255 | WP_275598580.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
N0Q90_RS21910 (N0Q90_21915) | 461979..462599 | - | 621 | WP_275598581.1 | hypothetical protein | - |
N0Q90_RS21915 (N0Q90_21920) | 463331..464005 | - | 675 | WP_275602695.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
N0Q90_RS21920 (N0Q90_21925) | 464375..464788 | - | 414 | WP_275598582.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..772647 | 772647 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14269.53 Da Isoelectric Point: 7.5964
>T257293 WP_275598578.1 NZ_CP104128:459947-460330 [Sinorhizobium sp. M103]
VILADTSIWIDHFRHTDAELRRIVEDDRLLCHPAVIGELALGSLRERSSVIAFLMAQREALVATHHEVMMMVDRHAIFSM
GIGYTDAHLLASVLLDKRVALWTRDKRLRAAAEKAGASLHTPAHTRN
VILADTSIWIDHFRHTDAELRRIVEDDRLLCHPAVIGELALGSLRERSSVIAFLMAQREALVATHHEVMMMVDRHAIFSM
GIGYTDAHLLASVLLDKRVALWTRDKRLRAAAEKAGASLHTPAHTRN
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|