Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-RelB |
Location | 390294..390892 | Replicon | plasmid pM103b |
Accession | NZ_CP104128 | ||
Organism | Sinorhizobium sp. M103 |
Toxin (Protein)
Gene name | relE | Uniprot ID | Q930F0 |
Locus tag | N0Q90_RS21555 | Protein ID | WP_010967243.1 |
Coordinates | 390294..390587 (-) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | N0Q90_RS21560 | Protein ID | WP_275598527.1 |
Coordinates | 390584..390892 (-) | Length | 103 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0Q90_RS21525 (N0Q90_21530) | 385799..386041 | + | 243 | WP_275598523.1 | hypothetical protein | - |
N0Q90_RS21530 (N0Q90_21535) | 386090..386185 | + | 96 | Protein_384 | cold-shock protein | - |
N0Q90_RS21535 (N0Q90_21540) | 386443..386835 | - | 393 | WP_275598524.1 | response regulator | - |
N0Q90_RS21540 (N0Q90_21545) | 387043..388173 | - | 1131 | WP_275598525.1 | IS1595 family transposase | - |
N0Q90_RS21545 (N0Q90_21550) | 388341..388642 | - | 302 | Protein_387 | plasmid partitioning protein RepB C-terminal domain-containing protein | - |
N0Q90_RS21550 (N0Q90_21555) | 388833..390033 | + | 1201 | Protein_388 | NAD-dependent formate dehydrogenase | - |
N0Q90_RS21555 (N0Q90_21560) | 390294..390587 | - | 294 | WP_010967243.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | Toxin |
N0Q90_RS21560 (N0Q90_21565) | 390584..390892 | - | 309 | WP_275598527.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
N0Q90_RS21565 (N0Q90_21570) | 391098..391526 | - | 429 | WP_275598528.1 | GNAT family N-acetyltransferase | - |
N0Q90_RS21570 (N0Q90_21575) | 392538..392654 | - | 117 | Protein_392 | cation transporter | - |
N0Q90_RS21575 (N0Q90_21580) | 392853..393386 | + | 534 | Protein_393 | short-chain dehydrogenase | - |
N0Q90_RS21580 (N0Q90_21585) | 393571..393798 | - | 228 | WP_003525968.1 | hypothetical protein | - |
N0Q90_RS21585 (N0Q90_21590) | 393875..394768 | - | 894 | WP_275598529.1 | AraC family transcriptional regulator | - |
N0Q90_RS21590 (N0Q90_21595) | 394981..395382 | - | 402 | WP_275598530.1 | periplasmic heavy metal sensor | - |
N0Q90_RS21595 (N0Q90_21600) | 395379..395828 | - | 450 | WP_275598531.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..772647 | 772647 | |
- | flank | IS/Tn | - | - | 387043..388173 | 1130 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11278.93 Da Isoelectric Point: 6.4734
>T257292 WP_010967243.1 NZ_CP104128:c390587-390294 [Sinorhizobium sp. M103]
MRLVWARYALDDRDTIFSYIERENPRAAVHVDEEIVSAVRRLLDFPESGRPGRIAGTRELVIPRTPYIAAYMVMEDRIRI
LRVLHGAQKWPSELDDG
MRLVWARYALDDRDTIFSYIERENPRAAVHVDEEIVSAVRRLLDFPESGRPGRIAGTRELVIPRTPYIAAYMVMEDRIRI
LRVLHGAQKWPSELDDG
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|