Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 396809..397485 | Replicon | plasmid pM103a |
| Accession | NZ_CP104127 | ||
| Organism | Sinorhizobium sp. M103 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | N0Q90_RS04710 | Protein ID | WP_275596863.1 |
| Coordinates | 397069..397485 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A2N8K0L2 |
| Locus tag | N0Q90_RS04705 | Protein ID | WP_018094055.1 |
| Coordinates | 396809..397072 (+) | Length | 88 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N0Q90_RS04675 (N0Q90_04675) | 391873..393079 | + | 1207 | Protein_373 | MFS transporter | - |
| N0Q90_RS04680 (N0Q90_04680) | 393076..393579 | - | 504 | WP_275599960.1 | TetR/AcrR family transcriptional regulator | - |
| N0Q90_RS04685 (N0Q90_04685) | 393688..394455 | + | 768 | WP_275596865.1 | SDR family NAD(P)-dependent oxidoreductase | - |
| N0Q90_RS04690 (N0Q90_04690) | 394476..394817 | + | 342 | WP_100670025.1 | carboxymuconolactone decarboxylase family protein | - |
| N0Q90_RS04695 (N0Q90_04695) | 395250..395948 | - | 699 | WP_275596864.1 | TetR/AcrR family transcriptional regulator C-terminal domain-containing protein | - |
| N0Q90_RS04700 (N0Q90_04700) | 396143..396631 | + | 489 | WP_100669718.1 | RidA family protein | - |
| N0Q90_RS04705 (N0Q90_04705) | 396809..397072 | + | 264 | WP_018094055.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| N0Q90_RS04710 (N0Q90_04710) | 397069..397485 | + | 417 | WP_275596863.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| N0Q90_RS04715 (N0Q90_04715) | 397482..398099 | + | 618 | WP_275596862.1 | hypothetical protein | - |
| N0Q90_RS04720 (N0Q90_04720) | 398191..399336 | + | 1146 | WP_275596861.1 | alpha-hydroxy acid oxidase | - |
| N0Q90_RS04725 (N0Q90_04725) | 399607..400077 | - | 471 | WP_275596860.1 | aminoacyl-tRNA deacylase | - |
| N0Q90_RS04730 (N0Q90_04730) | 400261..400938 | - | 678 | WP_275596859.1 | isoprenylcysteine carboxylmethyltransferase family protein | - |
| N0Q90_RS04735 (N0Q90_04735) | 401403..401834 | - | 432 | WP_100669711.1 | DUF1810 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | kdsB / adeG / fliE / fliQ / flhA / icl / htpB / acpXL / tufA / tufA / kdsA / acpXL / pgm | 1..3521513 | 3521513 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15391.92 Da Isoelectric Point: 8.9532
>T257287 WP_275596863.1 NZ_CP104127:397069-397485 [Sinorhizobium sp. M103]
MSLWMLDTKIAGHVIKGDRPEIIDRLVSLPITDIVVSSVTEGELLYGLAKRGYPRTLSERVRQFLLRVDVLPWNRTAARS
YGDLRAACEAKGAALAPLDMMIAAHAVAFDAVLVTRDRAFTRVAEPLKTDDWTDQKLK
MSLWMLDTKIAGHVIKGDRPEIIDRLVSLPITDIVVSSVTEGELLYGLAKRGYPRTLSERVRQFLLRVDVLPWNRTAARS
YGDLRAACEAKGAALAPLDMMIAAHAVAFDAVLVTRDRAFTRVAEPLKTDDWTDQKLK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|