Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 14130..14773 Replicon plasmid pEC1-49610
Accession NZ_CP104124
Organism Escherichia coli strain USDA-ARS-USMARC-49610

Toxin (Protein)


Gene name vagD Uniprot ID Q84A06
Locus tag N1705_RS22880 Protein ID WP_000754566.1
Coordinates 14130..14546 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID -
Locus tag N1705_RS22885 Protein ID WP_023300761.1
Coordinates 14543..14773 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N1705_RS22850 (N1705_22850) 9405..10643 - 1239 WP_000004159.1 macrolide resistance MFS transporter Mrx(A) -
N1705_RS22855 (N1705_22855) 10640..11545 - 906 WP_000219391.1 Mph(A) family macrolide 2'-phosphotransferase -
N1705_RS22860 (N1705_22860) 11667..12098 - 432 Protein_14 transposase -
N1705_RS22865 (N1705_22865) 12215..12403 + 189 WP_000957857.1 hypothetical protein -
N1705_RS22870 (N1705_22870) 12413..13612 + 1200 WP_000948429.1 IS91 family transposase -
N1705_RS22875 (N1705_22875) 13784..14049 - 266 Protein_17 DDE-type integrase/transposase/recombinase -
N1705_RS22880 (N1705_22880) 14130..14546 - 417 WP_000754566.1 type II toxin-antitoxin system VapC family toxin Toxin
N1705_RS22885 (N1705_22885) 14543..14773 - 231 WP_023300761.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
N1705_RS22890 (N1705_22890) 15383..15676 + 294 WP_020956883.1 hypothetical protein -
N1705_RS22895 (N1705_22895) 15740..16426 + 687 WP_020956882.1 hypothetical protein -
N1705_RS22900 (N1705_22900) 16438..17214 + 777 WP_020956881.1 tyrosine-type recombinase/integrase -
N1705_RS22905 (N1705_22905) 17272..17529 - 258 WP_000764642.1 hypothetical protein -
N1705_RS22910 (N1705_22910) 17658..17762 - 105 WP_032409716.1 hypothetical protein -
N1705_RS22915 (N1705_22915) 18292..19158 + 867 WP_004118283.1 replication initiation protein -
N1705_RS22920 (N1705_22920) 19335..19604 - 270 WP_000339857.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid qnrA1 / aadA2 / qacE / sul1 / mph(A) / floR / tet(A) / dfrA1 - 1..48623 48623


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15006.52 Da        Isoelectric Point: 9.2957

>T257285 WP_000754566.1 NZ_CP104124:c14546-14130 [Escherichia coli]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNVREFARVPGLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8765.84 Da        Isoelectric Point: 4.4189

>AT257285 WP_023300761.1 NZ_CP104124:c14773-14543 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDRIILRPVRPTWGSFAELEKADADFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A387K1G3

Antitoxin

Source ID Structure

References