Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
| Location | 3517905..3518742 | Replicon | chromosome |
| Accession | NZ_CP104123 | ||
| Organism | Escherichia coli strain USDA-ARS-USMARC-49610 | ||
Toxin (Protein)
| Gene name | itaT | Uniprot ID | - |
| Locus tag | N1705_RS16925 | Protein ID | WP_219411486.1 |
| Coordinates | 3518200..3518742 (+) | Length | 181 a.a. |
Antitoxin (Protein)
| Gene name | itaR | Uniprot ID | - |
| Locus tag | N1705_RS16920 | Protein ID | WP_097449025.1 |
| Coordinates | 3517905..3518216 (+) | Length | 104 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N1705_RS16895 (3512925) | 3512925..3513872 | + | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
| N1705_RS16900 (3513894) | 3513894..3515885 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
| N1705_RS16905 (3515875) | 3515875..3516489 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
| N1705_RS16910 (3516489) | 3516489..3516818 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
| N1705_RS16915 (3516830) | 3516830..3517720 | + | 891 | WP_000971336.1 | heme o synthase | - |
| N1705_RS16920 (3517905) | 3517905..3518216 | + | 312 | WP_097449025.1 | DUF1778 domain-containing protein | Antitoxin |
| N1705_RS16925 (3518200) | 3518200..3518742 | + | 543 | WP_219411486.1 | GNAT family N-acetyltransferase | Toxin |
| N1705_RS16930 (3518798) | 3518798..3519733 | - | 936 | WP_001297127.1 | tetratricopeptide repeat protein | - |
| N1705_RS16935 (3520141) | 3520141..3521505 | + | 1365 | WP_001000978.1 | MFS transporter | - |
| N1705_RS16940 (3521633) | 3521633..3522124 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
| N1705_RS16945 (3522292) | 3522292..3523203 | + | 912 | WP_000705865.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19831.10 Da Isoelectric Point: 8.3395
>T257279 WP_219411486.1 NZ_CP104123:3518200-3518742 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGLQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGLQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|