Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3483826..3484444 | Replicon | chromosome |
| Accession | NZ_CP104123 | ||
| Organism | Escherichia coli strain USDA-ARS-USMARC-49610 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | - |
| Locus tag | N1705_RS16755 | Protein ID | WP_219411483.1 |
| Coordinates | 3484226..3484444 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | N1705_RS16750 | Protein ID | WP_000344800.1 |
| Coordinates | 3483826..3484200 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N1705_RS16740 (3478915) | 3478915..3480108 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| N1705_RS16745 (3480131) | 3480131..3483280 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
| N1705_RS16750 (3483826) | 3483826..3484200 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| N1705_RS16755 (3484226) | 3484226..3484444 | + | 219 | WP_219411483.1 | HHA domain-containing protein | Toxin |
| N1705_RS16760 (3484615) | 3484615..3485166 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
| N1705_RS16765 (3485283) | 3485283..3485753 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| N1705_RS16770 (3485917) | 3485917..3487467 | + | 1551 | WP_001299455.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| N1705_RS16775 (3487509) | 3487509..3487862 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| N1705_RS16785 (3488241) | 3488241..3488552 | + | 312 | WP_000409911.1 | MGMT family protein | - |
| N1705_RS16790 (3488583) | 3488583..3489155 | - | 573 | WP_000779826.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8631.99 Da Isoelectric Point: 8.9008
>T257278 WP_219411483.1 NZ_CP104123:3484226-3484444 [Escherichia coli]
MSEKTLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKTLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT257278 WP_000344800.1 NZ_CP104123:3483826-3484200 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|