Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 1430216..1430841 | Replicon | chromosome |
| Accession | NZ_CP104123 | ||
| Organism | Escherichia coli strain USDA-ARS-USMARC-49610 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | N1705_RS06950 | Protein ID | WP_000911330.1 |
| Coordinates | 1430443..1430841 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | U9XQV3 |
| Locus tag | N1705_RS06945 | Protein ID | WP_000450524.1 |
| Coordinates | 1430216..1430443 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N1705_RS06920 (1426019) | 1426019..1426489 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
| N1705_RS06925 (1426489) | 1426489..1427061 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
| N1705_RS06930 (1427207) | 1427207..1428085 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| N1705_RS06935 (1428102) | 1428102..1429136 | + | 1035 | WP_001330579.1 | outer membrane protein assembly factor BamC | - |
| N1705_RS06940 (1429349) | 1429349..1430062 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| N1705_RS06945 (1430216) | 1430216..1430443 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| N1705_RS06950 (1430443) | 1430443..1430841 | + | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| N1705_RS06955 (1430988) | 1430988..1431851 | + | 864 | WP_001267498.1 | neutral zinc metallopeptidase | - |
| N1705_RS06960 (1431866) | 1431866..1433881 | + | 2016 | WP_219411424.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
| N1705_RS06965 (1433955) | 1433955..1434653 | + | 699 | WP_000679812.1 | esterase | - |
| N1705_RS06970 (1434763) | 1434763..1434963 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T257270 WP_000911330.1 NZ_CP104123:1430443-1430841 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|