Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 1124332..1124915 | Replicon | chromosome |
Accession | NZ_CP104123 | ||
Organism | Escherichia coli strain USDA-ARS-USMARC-49610 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | S1EZP4 |
Locus tag | N1705_RS05455 | Protein ID | WP_000254738.1 |
Coordinates | 1124580..1124915 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | N1705_RS05450 | Protein ID | WP_000581937.1 |
Coordinates | 1124332..1124580 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N1705_RS05440 (1120671) | 1120671..1121972 | + | 1302 | WP_000046800.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
N1705_RS05445 (1122020) | 1122020..1124254 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
N1705_RS05450 (1124332) | 1124332..1124580 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
N1705_RS05455 (1124580) | 1124580..1124915 | + | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
N1705_RS05460 (1124986) | 1124986..1125777 | + | 792 | WP_219411660.1 | nucleoside triphosphate pyrophosphohydrolase | - |
N1705_RS05465 (1126005) | 1126005..1127642 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
N1705_RS05470 (1127730) | 1127730..1129028 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T257268 WP_000254738.1 NZ_CP104123:1124580-1124915 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|