Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 998144..998804 | Replicon | chromosome |
| Accession | NZ_CP104123 | ||
| Organism | Escherichia coli strain USDA-ARS-USMARC-49610 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A3W5XVE6 |
| Locus tag | N1705_RS04930 | Protein ID | WP_000244778.1 |
| Coordinates | 998391..998804 (+) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | N1705_RS04925 | Protein ID | WP_000354046.1 |
| Coordinates | 998144..998410 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N1705_RS04900 (993313) | 993313..994056 | + | 744 | WP_075826628.1 | SDR family oxidoreductase | - |
| N1705_RS04905 (994113) | 994113..995546 | - | 1434 | WP_001343615.1 | 6-phospho-beta-glucosidase BglA | - |
| N1705_RS04910 (995591) | 995591..995902 | + | 312 | WP_001182954.1 | N(4)-acetylcytidine aminohydrolase | - |
| N1705_RS04915 (996066) | 996066..996725 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
| N1705_RS04920 (996921) | 996921..997901 | - | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
| N1705_RS04925 (998144) | 998144..998410 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| N1705_RS04930 (998391) | 998391..998804 | + | 414 | WP_000244778.1 | protein YgfX | Toxin |
| N1705_RS04935 (998838) | 998838..999359 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
| N1705_RS04940 (999471) | 999471..1000367 | + | 897 | WP_000806654.1 | site-specific tyrosine recombinase XerD | - |
| N1705_RS04945 (1000391) | 1000391..1001101 | + | 711 | WP_000715231.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| N1705_RS04950 (1001107) | 1001107..1002840 | + | 1734 | WP_000813212.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16275.23 Da Isoelectric Point: 11.7064
>T257267 WP_000244778.1 NZ_CP104123:998391-998804 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQRSR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQRSR
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3W5XVE6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6B58 | |
| PDB | 1X6I | |
| PDB | 1X6J | |
| PDB | 6C12 | |
| AlphaFold DB | A0A7U9QD57 |