257261

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 12638..13281 Replicon plasmid pEc3-50748
Accession NZ_CP104120
Organism Escherichia coli strain USDA-ARS-USMARC-50748

Toxin (Protein)


Gene name vagD Uniprot ID Q84A06
Locus tag N1709_RS25210 Protein ID WP_000754566.1
Coordinates 12865..13281 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q84A07
Locus tag N1709_RS25205 Protein ID WP_001261276.1
Coordinates 12638..12868 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N1709_RS25170 (N1709_25170) 7757..8026 + 270 WP_000339857.1 hypothetical protein -
N1709_RS25175 (N1709_25175) 8203..9069 - 867 WP_004118283.1 replication initiation protein -
N1709_RS25180 (N1709_25180) 9599..9703 + 105 WP_032409716.1 hypothetical protein -
N1709_RS25185 (N1709_25185) 9832..10089 + 258 WP_000764642.1 hypothetical protein -
N1709_RS25190 (N1709_25190) 10147..10923 - 777 WP_000015958.1 site-specific integrase -
N1709_RS25195 (N1709_25195) 10920..11663 - 744 WP_000129823.1 hypothetical protein -
N1709_RS25200 (N1709_25200) 11714..12064 - 351 WP_000493378.1 hypothetical protein -
N1709_RS25205 (N1709_25205) 12638..12868 + 231 WP_001261276.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
N1709_RS25210 (N1709_25210) 12865..13281 + 417 WP_000754566.1 type II toxin-antitoxin system VapC family toxin Toxin
N1709_RS25215 (N1709_25215) 13485..14341 + 857 Protein_16 IS3-like element ISEc15 family transposase -
N1709_RS25220 (N1709_25220) 14623..15699 + 1077 WP_000227969.1 IS110 family transposase -
N1709_RS25225 (N1709_25225) 15719..15820 - 102 Protein_18 Tn3 family transposase -
N1709_RS25230 (N1709_25230) 16340..16423 + 84 Protein_19 SOS response-associated peptidase -
N1709_RS25235 (N1709_25235) 16754..17188 - 435 WP_000429836.1 Hg(II)-responsive transcriptional regulator -
N1709_RS25240 (N1709_25240) 17260..17610 + 351 WP_001294663.1 mercuric transport protein MerT -
N1709_RS25245 (N1709_25245) 17624..17899 + 276 WP_000732292.1 mercury resistance system periplasmic binding protein MerP -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid floR / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / blaTEM-1A - 1..48650 48650


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15006.52 Da        Isoelectric Point: 9.2957

>T257261 WP_000754566.1 NZ_CP104120:12865-13281 [Escherichia coli]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNVREFARVPGLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8721.74 Da        Isoelectric Point: 4.3533

>AT257261 WP_001261276.1 NZ_CP104120:12638-12868 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A387K1G3

Antitoxin

Source ID Structure
AlphaFold DB A0A387K023

References