Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
| Location | 3679798..3680635 | Replicon | chromosome |
| Accession | NZ_CP104117 | ||
| Organism | Escherichia coli strain USDA-ARS-USMARC-50748 | ||
Toxin (Protein)
| Gene name | itaT | Uniprot ID | Q3Z4X7 |
| Locus tag | N1709_RS18080 | Protein ID | WP_000227784.1 |
| Coordinates | 3680093..3680635 (+) | Length | 181 a.a. |
Antitoxin (Protein)
| Gene name | itaR | Uniprot ID | I2UQS9 |
| Locus tag | N1709_RS18075 | Protein ID | WP_001297137.1 |
| Coordinates | 3679798..3680109 (+) | Length | 104 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N1709_RS18050 (3674818) | 3674818..3675765 | + | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
| N1709_RS18055 (3675787) | 3675787..3677778 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
| N1709_RS18060 (3677768) | 3677768..3678382 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
| N1709_RS18065 (3678382) | 3678382..3678711 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
| N1709_RS18070 (3678723) | 3678723..3679613 | + | 891 | WP_000971336.1 | heme o synthase | - |
| N1709_RS18075 (3679798) | 3679798..3680109 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
| N1709_RS18080 (3680093) | 3680093..3680635 | + | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
| N1709_RS18085 (3680691) | 3680691..3681626 | - | 936 | WP_260252263.1 | tetratricopeptide repeat protein | - |
| N1709_RS18090 (3682034) | 3682034..3683398 | + | 1365 | WP_001000978.1 | MFS transporter | - |
| N1709_RS18095 (3683526) | 3683526..3684017 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
| N1709_RS18100 (3684185) | 3684185..3685096 | + | 912 | WP_000705847.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T257253 WP_000227784.1 NZ_CP104117:3680093-3680635 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|