Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2602520..2603158 | Replicon | chromosome |
| Accession | NZ_CP104117 | ||
| Organism | Escherichia coli strain USDA-ARS-USMARC-50748 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | N1709_RS12840 | Protein ID | WP_000813794.1 |
| Coordinates | 2602982..2603158 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | N1709_RS12835 | Protein ID | WP_001270286.1 |
| Coordinates | 2602520..2602936 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N1709_RS12815 (2597672) | 2597672..2598613 | - | 942 | WP_001251319.1 | ABC transporter permease | - |
| N1709_RS12820 (2598614) | 2598614..2599627 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
| N1709_RS12825 (2599645) | 2599645..2600790 | - | 1146 | WP_000047456.1 | ABC transporter substrate-binding protein | - |
| N1709_RS12830 (2601035) | 2601035..2602441 | - | 1407 | WP_000760629.1 | PLP-dependent aminotransferase family protein | - |
| N1709_RS12835 (2602520) | 2602520..2602936 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| N1709_RS12840 (2602982) | 2602982..2603158 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| N1709_RS12845 (2603380) | 2603380..2603610 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| N1709_RS12850 (2603702) | 2603702..2605663 | - | 1962 | WP_032219733.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| N1709_RS12855 (2605736) | 2605736..2606272 | - | 537 | WP_000429141.1 | DNA-binding transcriptional regulator SutR | - |
| N1709_RS12860 (2606325) | 2606325..2607539 | + | 1215 | WP_001349372.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2607579..2608844 | 1265 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T257250 WP_000813794.1 NZ_CP104117:c2603158-2602982 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT257250 WP_001270286.1 NZ_CP104117:c2602936-2602520 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|