Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1408032..1408657 | Replicon | chromosome |
Accession | NZ_CP104117 | ||
Organism | Escherichia coli strain USDA-ARS-USMARC-50748 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | N1709_RS06890 | Protein ID | WP_000911330.1 |
Coordinates | 1408259..1408657 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | N1709_RS06885 | Protein ID | WP_000450524.1 |
Coordinates | 1408032..1408259 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N1709_RS06860 (1403835) | 1403835..1404305 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
N1709_RS06865 (1404305) | 1404305..1404877 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
N1709_RS06870 (1405023) | 1405023..1405901 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
N1709_RS06875 (1405918) | 1405918..1406952 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
N1709_RS06880 (1407165) | 1407165..1407878 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
N1709_RS06885 (1408032) | 1408032..1408259 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
N1709_RS06890 (1408259) | 1408259..1408657 | + | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N1709_RS06895 (1408804) | 1408804..1409667 | + | 864 | WP_001267508.1 | neutral zinc metallopeptidase | - |
N1709_RS06900 (1409682) | 1409682..1411697 | + | 2016 | WP_000829329.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
N1709_RS06905 (1411771) | 1411771..1412469 | + | 699 | WP_000679823.1 | esterase | - |
N1709_RS06910 (1412579) | 1412579..1412779 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T257242 WP_000911330.1 NZ_CP104117:1408259-1408657 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|