Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3658778..3659432 | Replicon | chromosome |
| Accession | NZ_CP104112 | ||
| Organism | Escherichia coli strain USDA-ARS-USMARC-51688 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1EEB2 |
| Locus tag | N1707_RS17905 | Protein ID | WP_000244777.1 |
| Coordinates | 3658778..3659185 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | N1707_RS17910 | Protein ID | WP_000354046.1 |
| Coordinates | 3659166..3659432 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N1707_RS17885 (3654735) | 3654735..3656468 | - | 1734 | WP_000813212.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| N1707_RS17890 (3656474) | 3656474..3657184 | - | 711 | WP_000715216.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| N1707_RS17895 (3657209) | 3657209..3658105 | - | 897 | WP_000806639.1 | site-specific tyrosine recombinase XerD | - |
| N1707_RS17900 (3658217) | 3658217..3658738 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
| N1707_RS17905 (3658778) | 3658778..3659185 | - | 408 | WP_000244777.1 | protein YgfX | Toxin |
| N1707_RS17910 (3659166) | 3659166..3659432 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| N1707_RS17915 (3659675) | 3659675..3660655 | + | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
| N1707_RS17920 (3660851) | 3660851..3661510 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
| N1707_RS17925 (3661674) | 3661674..3661985 | - | 312 | WP_001182954.1 | N(4)-acetylcytidine aminohydrolase | - |
| N1707_RS17930 (3662030) | 3662030..3663463 | + | 1434 | WP_001338826.1 | 6-phospho-beta-glucosidase BglA | - |
| N1707_RS17935 (3663520) | 3663520..3664263 | - | 744 | WP_000951948.1 | SDR family oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16031.96 Da Isoelectric Point: 11.5202
>T257212 WP_000244777.1 NZ_CP104112:c3659185-3658778 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LFV7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6B58 | |
| PDB | 1X6I | |
| PDB | 1X6J | |
| PDB | 6C12 | |
| AlphaFold DB | A0A7U9QD57 |