Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2144593..2145231 | Replicon | chromosome |
Accession | NZ_CP104112 | ||
Organism | Escherichia coli strain USDA-ARS-USMARC-51688 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | N1707_RS10480 | Protein ID | WP_000813794.1 |
Coordinates | 2144593..2144769 (+) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | N1707_RS10485 | Protein ID | WP_001270286.1 |
Coordinates | 2144815..2145231 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N1707_RS10460 (2140212) | 2140212..2141426 | - | 1215 | WP_001326689.1 | BenE family transporter YdcO | - |
N1707_RS10465 (2141479) | 2141479..2142015 | + | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
N1707_RS10470 (2142088) | 2142088..2144049 | + | 1962 | WP_167788885.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
N1707_RS10475 (2144141) | 2144141..2144371 | - | 231 | WP_000494244.1 | YncJ family protein | - |
N1707_RS10480 (2144593) | 2144593..2144769 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
N1707_RS10485 (2144815) | 2144815..2145231 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
N1707_RS10490 (2145310) | 2145310..2146716 | + | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
N1707_RS10495 (2146961) | 2146961..2148106 | + | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
N1707_RS10500 (2148124) | 2148124..2149137 | + | 1014 | WP_000220399.1 | ABC transporter ATP-binding protein | - |
N1707_RS10505 (2149138) | 2149138..2150079 | + | 942 | WP_001251313.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T257204 WP_000813794.1 NZ_CP104112:2144593-2144769 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT257204 WP_001270286.1 NZ_CP104112:2144815-2145231 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|