Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
Location | 1565358..1566063 | Replicon | chromosome |
Accession | NZ_CP104112 | ||
Organism | Escherichia coli strain USDA-ARS-USMARC-51688 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1F406 |
Locus tag | N1707_RS07610 | Protein ID | WP_000539521.1 |
Coordinates | 1565677..1566063 (-) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | N1707_RS07605 | Protein ID | WP_001280945.1 |
Coordinates | 1565358..1565687 (-) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N1707_RS07595 (1561604) | 1561604..1563952 | + | 2349 | WP_001338403.1 | EAL domain-containing protein | - |
N1707_RS07600 (1563960) | 1563960..1565288 | + | 1329 | WP_000086877.1 | GGDEF domain-containing protein | - |
N1707_RS07605 (1565358) | 1565358..1565687 | - | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
N1707_RS07610 (1565677) | 1565677..1566063 | - | 387 | WP_000539521.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N1707_RS07615 (1566289) | 1566289..1567614 | - | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
N1707_RS07620 (1567827) | 1567827..1568210 | + | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
N1707_RS07625 (1568321) | 1568321..1569436 | + | 1116 | WP_000555031.1 | aldose sugar dehydrogenase YliI | - |
N1707_RS07630 (1569433) | 1569433..1570059 | - | 627 | WP_001295292.1 | glutathione S-transferase GstB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14293.45 Da Isoelectric Point: 9.9296
>T257197 WP_000539521.1 NZ_CP104112:c1566063-1565677 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|