Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1145796..1146414 | Replicon | chromosome |
Accession | NZ_CP104112 | ||
Organism | Escherichia coli strain USDA-ARS-USMARC-51688 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | N1707_RS05575 | Protein ID | WP_001291435.1 |
Coordinates | 1145796..1146014 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | N1707_RS05580 | Protein ID | WP_000344800.1 |
Coordinates | 1146040..1146414 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N1707_RS05540 (1141085) | 1141085..1141657 | + | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
N1707_RS05545 (1141688) | 1141688..1141999 | - | 312 | WP_000409911.1 | MGMT family protein | - |
N1707_RS05555 (1142378) | 1142378..1142731 | + | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
N1707_RS05560 (1142773) | 1142773..1144323 | - | 1551 | WP_001310610.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
N1707_RS05565 (1144487) | 1144487..1144957 | - | 471 | WP_000136192.1 | YlaC family protein | - |
N1707_RS05570 (1145073) | 1145073..1145624 | - | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
N1707_RS05575 (1145796) | 1145796..1146014 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
N1707_RS05580 (1146040) | 1146040..1146414 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
N1707_RS05585 (1146960) | 1146960..1150109 | - | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
N1707_RS05590 (1150132) | 1150132..1151325 | - | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T257196 WP_001291435.1 NZ_CP104112:c1146014-1145796 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT257196 WP_000344800.1 NZ_CP104112:c1146414-1146040 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |