Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 5285398..5286023 | Replicon | chromosome |
Accession | NZ_CP104110 | ||
Organism | Klebsiella pneumoniae strain USDA-ARS-USMARC-52099 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | R4Y4A3 |
Locus tag | N1708_RS25650 | Protein ID | WP_002882817.1 |
Coordinates | 5285398..5285781 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | J2DFR0 |
Locus tag | N1708_RS25655 | Protein ID | WP_004150355.1 |
Coordinates | 5285781..5286023 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N1708_RS25635 (5282764) | 5282764..5283666 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
N1708_RS25640 (5283663) | 5283663..5284298 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
N1708_RS25645 (5284295) | 5284295..5285224 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
N1708_RS25650 (5285398) | 5285398..5285781 | - | 384 | WP_002882817.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N1708_RS25655 (5285781) | 5285781..5286023 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
N1708_RS25660 (5286228) | 5286228..5287145 | + | 918 | WP_080851918.1 | alpha/beta hydrolase | - |
N1708_RS25665 (5287159) | 5287159..5288100 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
N1708_RS25670 (5288145) | 5288145..5288582 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
N1708_RS25675 (5288579) | 5288579..5289439 | - | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
N1708_RS25680 (5289433) | 5289433..5290032 | - | 600 | WP_064167924.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T257192 WP_002882817.1 NZ_CP104110:c5285781-5285398 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GPK8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GGU9 |