Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4022228..4022847 | Replicon | chromosome |
| Accession | NZ_CP104110 | ||
| Organism | Klebsiella pneumoniae strain USDA-ARS-USMARC-52099 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | N1708_RS19615 | Protein ID | WP_002892050.1 |
| Coordinates | 4022629..4022847 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | J2DPF6 |
| Locus tag | N1708_RS19610 | Protein ID | WP_002892066.1 |
| Coordinates | 4022228..4022602 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N1708_RS19600 (4017380) | 4017380..4018573 | + | 1194 | WP_004177236.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| N1708_RS19605 (4018596) | 4018596..4021742 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| N1708_RS19610 (4022228) | 4022228..4022602 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
| N1708_RS19615 (4022629) | 4022629..4022847 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| N1708_RS19620 (4023010) | 4023010..4023576 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
| N1708_RS19625 (4023548) | 4023548..4023688 | - | 141 | WP_004147370.1 | hypothetical protein | - |
| N1708_RS19630 (4023709) | 4023709..4024179 | + | 471 | WP_002892026.1 | YlaC family protein | - |
| N1708_RS19635 (4024154) | 4024154..4025605 | - | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
| N1708_RS19640 (4025706) | 4025706..4026404 | + | 699 | WP_002892021.1 | GNAT family protein | - |
| N1708_RS19645 (4026401) | 4026401..4026541 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| N1708_RS19650 (4026541) | 4026541..4026804 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T257187 WP_002892050.1 NZ_CP104110:4022629-4022847 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT257187 WP_002892066.1 NZ_CP104110:4022228-4022602 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GJ93 |