Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4022228..4022847 Replicon chromosome
Accession NZ_CP104110
Organism Klebsiella pneumoniae strain USDA-ARS-USMARC-52099

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag N1708_RS19615 Protein ID WP_002892050.1
Coordinates 4022629..4022847 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag N1708_RS19610 Protein ID WP_002892066.1
Coordinates 4022228..4022602 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N1708_RS19600 (4017380) 4017380..4018573 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
N1708_RS19605 (4018596) 4018596..4021742 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
N1708_RS19610 (4022228) 4022228..4022602 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
N1708_RS19615 (4022629) 4022629..4022847 + 219 WP_002892050.1 HHA domain-containing protein Toxin
N1708_RS19620 (4023010) 4023010..4023576 + 567 WP_002892030.1 maltose O-acetyltransferase -
N1708_RS19625 (4023548) 4023548..4023688 - 141 WP_004147370.1 hypothetical protein -
N1708_RS19630 (4023709) 4023709..4024179 + 471 WP_002892026.1 YlaC family protein -
N1708_RS19635 (4024154) 4024154..4025605 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
N1708_RS19640 (4025706) 4025706..4026404 + 699 WP_002892021.1 GNAT family protein -
N1708_RS19645 (4026401) 4026401..4026541 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
N1708_RS19650 (4026541) 4026541..4026804 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T257187 WP_002892050.1 NZ_CP104110:4022629-4022847 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT257187 WP_002892066.1 NZ_CP104110:4022228-4022602 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References