Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3096607..3097226 | Replicon | chromosome |
Accession | NZ_CP104108 | ||
Organism | Cronobacter sakazakii strain USDA-ARS-USMARC-54664 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | A0A2S9UIC9 |
Locus tag | N1710_RS14670 | Protein ID | WP_004386909.1 |
Coordinates | 3097008..3097226 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | A0A3Q9CL77 |
Locus tag | N1710_RS14665 | Protein ID | WP_004386908.1 |
Coordinates | 3096607..3096981 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N1710_RS14655 (N1710_14655) | 3091768..3092973 | + | 1206 | WP_007848022.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
N1710_RS14660 (N1710_14660) | 3092995..3096144 | + | 3150 | WP_007848020.1 | multidrug efflux RND transporter permease subunit AcrB | - |
N1710_RS14665 (N1710_14665) | 3096607..3096981 | + | 375 | WP_004386908.1 | Hha toxicity modulator TomB | Antitoxin |
N1710_RS14670 (N1710_14670) | 3097008..3097226 | + | 219 | WP_004386909.1 | HHA domain-containing protein | Toxin |
N1710_RS14675 (N1710_14675) | 3097433..3097984 | + | 552 | WP_004386910.1 | maltose O-acetyltransferase | - |
N1710_RS14680 (N1710_14680) | 3098104..3098613 | + | 510 | WP_105545632.1 | YlaC family protein | - |
N1710_RS14685 (N1710_14685) | 3098642..3098782 | - | 141 | WP_004386911.1 | type B 50S ribosomal protein L36 | - |
N1710_RS14690 (N1710_14690) | 3098786..3099046 | - | 261 | WP_105546096.1 | type B 50S ribosomal protein L31 | - |
N1710_RS14695 (N1710_14695) | 3099186..3101087 | - | 1902 | WP_014729414.1 | methyl-accepting chemotaxis protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8598.02 Da Isoelectric Point: 9.4828
>T257177 WP_004386909.1 NZ_CP104108:3097008-3097226 [Cronobacter sakazakii]
MTTKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTAVWKFVR
MTTKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTAVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14343.05 Da Isoelectric Point: 4.7168
>AT257177 WP_004386908.1 NZ_CP104108:3096607-3096981 [Cronobacter sakazakii]
MDEYSPKRHDIAQLKFLCESLYHDCLATLGENQHGWVNDPTSAVNLQLNDLIEHIASFGLNYKIKHEDDAALIEQLDEYL
DDTFMLFSNYGINAQDLQKWRKSGNRLFRCFVNASKENPVSLSF
MDEYSPKRHDIAQLKFLCESLYHDCLATLGENQHGWVNDPTSAVNLQLNDLIEHIASFGLNYKIKHEDDAALIEQLDEYL
DDTFMLFSNYGINAQDLQKWRKSGNRLFRCFVNASKENPVSLSF
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2S9UIC9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3Q9CL77 |