Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 762686..763349 | Replicon | chromosome |
| Accession | NZ_CP104108 | ||
| Organism | Cronobacter sakazakii strain USDA-ARS-USMARC-54664 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | N1710_RS03675 | Protein ID | WP_032987888.1 |
| Coordinates | 762933..763349 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A3Q9CFW7 |
| Locus tag | N1710_RS03670 | Protein ID | WP_007870701.1 |
| Coordinates | 762686..762952 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N1710_RS03645 (N1710_03645) | 757715..759148 | - | 1434 | WP_032987892.1 | 6-phospho-beta-glucosidase | - |
| N1710_RS03650 (N1710_03650) | 759300..760028 | - | 729 | WP_004385670.1 | MurR/RpiR family transcriptional regulator | - |
| N1710_RS03655 (N1710_03655) | 760205..760519 | + | 315 | WP_080321077.1 | N(4)-acetylcytidine aminohydrolase | - |
| N1710_RS03660 (N1710_03660) | 760661..761314 | + | 654 | WP_007777939.1 | hemolysin III family protein | - |
| N1710_RS03665 (N1710_03665) | 761419..762408 | - | 990 | WP_105546331.1 | tRNA-modifying protein YgfZ | - |
| N1710_RS03670 (N1710_03670) | 762686..762952 | + | 267 | WP_007870701.1 | FAD assembly factor SdhE | Antitoxin |
| N1710_RS03675 (N1710_03675) | 762933..763349 | + | 417 | WP_032987888.1 | protein YgfX | Toxin |
| N1710_RS03680 (N1710_03680) | 763363..763884 | - | 522 | WP_105546330.1 | flavodoxin FldB | - |
| N1710_RS03685 (N1710_03685) | 763986..764882 | + | 897 | WP_087600150.1 | site-specific tyrosine recombinase XerD | - |
| N1710_RS03690 (N1710_03690) | 764905..765624 | + | 720 | WP_004385678.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| N1710_RS03695 (N1710_03695) | 765628..767361 | + | 1734 | WP_007870697.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 16441.44 Da Isoelectric Point: 11.4887
>T257169 WP_032987888.1 NZ_CP104108:762933-763349 [Cronobacter sakazakii]
VVLWHSDLRVSWRSQWLSLLLHGAVAVIILLLPWPLRYLPVWMLLLSLVVFDCVRSQRRINAFQGEVSLTADYHLRWQGV
DWQICATPWMLRSGMMLRLRHPKTTRRHHVWLAADSMTEAEWRDLRRLLLQQPVGDKR
VVLWHSDLRVSWRSQWLSLLLHGAVAVIILLLPWPLRYLPVWMLLLSLVVFDCVRSQRRINAFQGEVSLTADYHLRWQGV
DWQICATPWMLRSGMMLRLRHPKTTRRHHVWLAADSMTEAEWRDLRRLLLQQPVGDKR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|