Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 599860..600379 | Replicon | chromosome |
Accession | NZ_CP104108 | ||
Organism | Cronobacter sakazakii strain USDA-ARS-USMARC-54664 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | N1710_RS02885 | Protein ID | WP_105546376.1 |
Coordinates | 600092..600379 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | N1710_RS02880 | Protein ID | WP_004385270.1 |
Coordinates | 599860..600102 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N1710_RS02865 (N1710_02865) | 595903..597021 | + | 1119 | WP_004385267.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
N1710_RS02870 (N1710_02870) | 597018..597758 | + | 741 | WP_004385268.1 | KDGP aldolase family protein | - |
N1710_RS02875 (N1710_02875) | 597872..599782 | + | 1911 | WP_004385269.1 | PRD domain-containing protein | - |
N1710_RS02880 (N1710_02880) | 599860..600102 | + | 243 | WP_004385270.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
N1710_RS02885 (N1710_02885) | 600092..600379 | + | 288 | WP_105546376.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N1710_RS02890 (N1710_02890) | 600387..600851 | - | 465 | WP_007871043.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
N1710_RS02895 (N1710_02895) | 601147..603282 | - | 2136 | WP_104676904.1 | anaerobic ribonucleoside-triphosphate reductase | - |
N1710_RS02900 (N1710_02900) | 603579..604460 | - | 882 | WP_007871040.1 | LysR family transcriptional regulator | - |
N1710_RS02905 (N1710_02905) | 604563..605093 | + | 531 | WP_105546375.1 | NAD(P)H-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10839.85 Da Isoelectric Point: 10.5836
>T257168 WP_105546376.1 NZ_CP104108:600092-600379 [Cronobacter sakazakii]
MSYKLVFDPRALKEWHKLGETVKAQFKKKLAHVLAAPRVKSARLSGLPDCYKIKLRTSGYRLVYQVRDDAVCVLVIAIGK
RENLTVYQGVGHRLE
MSYKLVFDPRALKEWHKLGETVKAQFKKKLAHVLAAPRVKSARLSGLPDCYKIKLRTSGYRLVYQVRDDAVCVLVIAIGK
RENLTVYQGVGHRLE
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|