Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
Location | 4823211..4823896 | Replicon | chromosome |
Accession | NZ_CP104107 | ||
Organism | Pseudomonas mosselii strain PH4 |
Toxin (Protein)
Gene name | tad | Uniprot ID | - |
Locus tag | N0U38_RS21940 | Protein ID | WP_260270432.1 |
Coordinates | 4823211..4823579 (+) | Length | 123 a.a. |
Antitoxin (Protein)
Gene name | ata | Uniprot ID | - |
Locus tag | N0U38_RS21945 | Protein ID | WP_260270433.1 |
Coordinates | 4823576..4823896 (+) | Length | 107 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0U38_RS21910 (N0U38_21910) | 4818700..4819425 | + | 726 | WP_011532417.1 | LPS export ABC transporter ATP-binding protein | - |
N0U38_RS21915 (N0U38_21915) | 4819599..4821098 | + | 1500 | WP_028689657.1 | RNA polymerase factor sigma-54 | - |
N0U38_RS21920 (N0U38_21920) | 4821177..4821485 | + | 309 | WP_011532415.1 | ribosome-associated translation inhibitor RaiA | - |
N0U38_RS21925 (N0U38_21925) | 4821498..4821974 | + | 477 | WP_260270430.1 | PTS IIA-like nitrogen regulatory protein PtsN | - |
N0U38_RS21930 (N0U38_21930) | 4821965..4822819 | + | 855 | WP_062572910.1 | RNase adapter RapZ | - |
N0U38_RS21935 (N0U38_21935) | 4822840..4823112 | + | 273 | WP_260270431.1 | HPr family phosphocarrier protein | - |
N0U38_RS21940 (N0U38_21940) | 4823211..4823579 | + | 369 | WP_260270432.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N0U38_RS21945 (N0U38_21945) | 4823576..4823896 | + | 321 | WP_260270433.1 | helix-turn-helix transcriptional regulator | Antitoxin |
N0U38_RS21950 (N0U38_21950) | 4823936..4824829 | - | 894 | WP_260272033.1 | ZIP family metal transporter | - |
N0U38_RS21955 (N0U38_21955) | 4824841..4825452 | - | 612 | WP_062572908.1 | superoxide dismutase | - |
N0U38_RS21960 (N0U38_21960) | 4825454..4825915 | - | 462 | WP_062572907.1 | hypothetical protein | - |
N0U38_RS21965 (N0U38_21965) | 4825941..4827317 | - | 1377 | WP_260270434.1 | class II fumarate hydratase | - |
N0U38_RS21970 (N0U38_21970) | 4827310..4827711 | - | 402 | WP_186735137.1 | FagA protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13500.56 Da Isoelectric Point: 9.7622
>T257166 WP_260270432.1 NZ_CP104107:4823211-4823579 [Pseudomonas mosselii]
MESDRQPKPLYWVASSKKDLLCLPEDIQQTVGFALHLAQTGSRHLQAKVLKGFSGAGVLEVVEDHDGNTYRAVYTVRLGA
AVYVLHCFQKKSKAGIRTPETDIALVRKRLKLAQAHSEGIQT
MESDRQPKPLYWVASSKKDLLCLPEDIQQTVGFALHLAQTGSRHLQAKVLKGFSGAGVLEVVEDHDGNTYRAVYTVRLGA
AVYVLHCFQKKSKAGIRTPETDIALVRKRLKLAQAHSEGIQT
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|